Mouse Anti-D. melanogaster Rpl29 Antibody (CBMOAB-29997FYA)
Cat: CBMOAB-29997FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Fruit fly (Drosophila melanogaster) |
| Clone | MO29997FYA |
| Specificity | This antibody binds to fruit fly Rpl29. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Cytosol |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a cytoplasmic ribosomal protein that is a component of the 60S subunit. The protein belongs to the L29E family of ribosomal proteins. The protein is also a peripheral membrane protein expressed on the cell surface that directly binds heparin. Although this gene was previously reported to map to 3q29-qter, it is believed that it is located at 3p21.3-p21.2. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. |
| Product Overview | Mouse Anti-D. melanogaster Rpl29 Antibody is a mouse antibody against Rpl29. It can be used for Rpl29 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | 60S ribosomal protein L29; L43; RpL29; RpL43 |
| UniProt ID | Q24154 |
| Protein Refseq | The length of the protein is 76 amino acids long. The sequence is show below: MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGNLSREESVKRYNERIASQKGKPKPVTL. |
See other products for " rpl29 "
| MO-AB-07242H | Mouse Anti-Frog rpl29 Antibody (MO-AB-07242H) |
| MO-AB-19501R | Mouse Anti-Cattle RPL29 Antibody (MO-AB-19501R) |
| CBMOAB-40406FYC | Mouse Anti-Arabidopsis RPL29 Antibody (CBMOAB-40406FYC) |
| CBMOAB-09308HCB | Mouse Anti-C. elegans RPL29 Antibody (CBMOAB-09308HCB) |
| MO-AB-70315W | Mouse Anti-Silkworm RpL29 Antibody (MO-AB-70315W) |
| MO-AB-63527W | Mouse Anti-Marmoset RPL29 Antibody (MO-AB-63527W) |
| MO-AB-28613H | Mouse Anti-Rat Rpl29 Antibody (MO-AB-28613H) |
| CBMOAB-03523CR | Mouse Anti-Yeast RPL29 Antibody (CBMOAB-03523CR) |
| MO-AB-33138W | Mouse Anti-Dog rpL29 Antibody (MO-AB-33138W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry