Mouse Anti-Silkworm RpL29 Antibody (MO-AB-70315W)
Cat: MO-AB-70315W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Silkworm (Bombyx mori) |
Clone | MO70315W |
Specificity | This antibody binds to Silkworm RpL29. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a cytoplasmic ribosomal protein that is a component of the 60S subunit. The protein belongs to the L29E family of ribosomal proteins. The protein is also a peripheral membrane protein expressed on the cell surface that directly binds heparin. Although this gene was previously reported to map to 3q29-qter, it is believed that it is located at 3p21.3-p21.2. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. |
Product Overview | Mouse Anti-Silkworm RpL29 Antibody is a mouse antibody against RpL29. It can be used for RpL29 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Ribosomal protein L29; RpL29 |
UniProt ID | Q5UAQ9 |
Protein Refseq | The length of the protein is 73 amino acids long. The sequence is show below: MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLKPAKQLARAAERKATREAKAKK. |
See other products for " RPL29 "
CBMOAB-09308HCB | Mouse Anti-C. elegans RPL29 Antibody (CBMOAB-09308HCB) |
CBMOAB-40406FYC | Mouse Anti-Arabidopsis RPL29 Antibody (CBMOAB-40406FYC) |
CBMOAB-29997FYA | Mouse Anti-D. melanogaster Rpl29 Antibody (CBMOAB-29997FYA) |
CBMOAB-03523CR | Mouse Anti-Yeast RPL29 Antibody (CBMOAB-03523CR) |
MO-AB-19501R | Mouse Anti-Cattle RPL29 Antibody (MO-AB-19501R) |
MO-AB-07242H | Mouse Anti-Frog rpl29 Antibody (MO-AB-07242H) |
MO-AB-63527W | Mouse Anti-Marmoset RPL29 Antibody (MO-AB-63527W) |
MO-AB-33138W | Mouse Anti-Dog rpL29 Antibody (MO-AB-33138W) |
MO-AB-28613H | Mouse Anti-Rat Rpl29 Antibody (MO-AB-28613H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry