Mouse Anti-Frog rpl29 Antibody (MO-AB-07242H)


Cat: MO-AB-07242H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO07242C
SpecificityThis antibody binds to Frog rpl29.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRibosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a cytoplasmic ribosomal protein that is a component of the 60S subunit. The protein belongs to the L29E family of ribosomal proteins. The protein is also a peripheral membrane protein expressed on the cell surface that directly binds heparin. Although this gene was previously reported to map to 3q29-qter, it is believed that it is located at 3p21.3-p21.2. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Product OverviewThis product is a mouse antibody against rpl29. It can be used for rpl29 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMGC64312 protein; rpl29
UniProt IDQ7SZA5
Protein RefseqThe length of the protein is 75 amino acids long.
The sequence is show below: MAKSKNHTTHNQSRKWHRNGIKKPVSQRYESLKGVDPKFLRNMRFAKKHNKKGIKKMLANNAKFAASAQAPAPAK.
For Research Use Only | Not For Clinical Use.
Online Inquiry