Mouse Anti-Dog GPX2 Antibody (MO-AB-31014W)
Cat: MO-AB-31014W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Dog (Canis lupus familiaris) |
Clone | MO31014W |
Specificity | This antibody binds to Dog GPX2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. This isozyme is predominantly expressed in the gastrointestinal tract (also in liver in human), is localized in the cytoplasm, and whose preferred substrate is hydrogen peroxide. Overexpression of this gene is associated with increased differentiation and proliferation in colorectal cancer. This isozyme is also a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Alternatively spliced transcript variants have been found for this gene. |
Product Overview | Mouse Anti-Dog GPX2 Antibody is a mouse antibody against GPX2. It can be used for GPX2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Glutathione peroxidase; GPX2 |
UniProt ID | F1Q0Z4 |
Protein Refseq | The length of the protein is 148 amino acids long. The sequence is show below: TTTRDFTQLNELQCRFPRRLVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGFQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPLSLMTDPKFIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKRLLKVA. |
See other products for " GPX2 "
MO-DKB-01993W | Rabbit Anti-GPX2 Antibody (MO-DKB-01993W) |
MO-AB-33270H | Mouse Anti-Nile tilapia GPX2 Antibody (MO-AB-33270H) |
MO-AB-00580L | Mouse Anti-Elephant GPX2 Antibody (MO-AB-00580L) |
MO-AB-00626R | Mouse Anti-Medaka GPX2 Antibody (MO-AB-00626R) |
CBMOAB-44070FYA | Mouse Anti-Rhesus GPX2 Antibody (CBMOAB-44070FYA) |
MO-AB-06534Y | Mouse Anti-O. anatinus GPX2 Antibody (MO-AB-06534Y) |
MO-AB-26101H | Mouse Anti-Rat Gpx2 Antibody (MO-AB-26101H) |
MO-AB-15582Y | Mouse Anti-Sheep GPX2 Antibody (MO-AB-15582Y) |
CBMOAB-04656HCB | Mouse Anti-C. elegans GPX2 Antibody (CBMOAB-04656HCB) |
MO-DKB-00678W | Rabbit Anti-GPX2 Antibody (MO-DKB-00678W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry