Mouse Anti-Dog sgk1 Antibody (MO-AB-33312W)
Cat: MO-AB-33312W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Dog (Canis lupus familiaris) |
Clone | MO33312W |
Specificity | This antibody binds to Dog sgk1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels, suggesting an involvement in the regulation of processes such as cell survival, neuronal excitability, and renal sodium excretion. High levels of expression of this gene may contribute to conditions such as hypertension and diabetic nephropathy. Several alternatively spliced transcript variants encoding different isoforms have been noted for this gene. |
Product Overview | Mouse Anti-Dog sgk1 Antibody is a mouse antibody against sgk1. It can be used for sgk1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Serum / glucocorticoid-regulated kinase 1; sgk1 |
UniProt ID | Q95N98 |
Protein Refseq | The length of the protein is 40 amino acids long. The sequence is show below: EPVPNSIGRSPDSILLTASVKEAAEAFLGFSYAPPMDSXL. |
See other products for " SGK1 "
MO-DKB-00768W | Rabbit Anti-SGK1 Antibody (MO-DKB-00768W) |
CBMOAB-97947FYA | Mouse Anti-Zebrafish sgk1 Antibody (CBMOAB-97947FYA) |
MO-AB-42540W | Mouse Anti-Guinea pig Sgk1 Antibody (MO-AB-42540W) |
MO-AB-24734W | Mouse Anti-Chimpanzee SGK1 Antibody (MO-AB-24734W) |
CBMOAB-09732HCB | Mouse Anti-C. elegans SGK1 Antibody (CBMOAB-09732HCB) |
MO-AB-64266W | Mouse Anti-Marmoset SGK1 Antibody (MO-AB-64266W) |
MO-AB-20064R | Mouse Anti-Cattle SGK1 Antibody (MO-AB-20064R) |
MO-AB-09903Y | Mouse Anti-Rabbit SGK1 Antibody (MO-AB-09903Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry