Mouse Anti-Guinea pig Sgk1 Antibody (MO-AB-42540W)


Cat: MO-AB-42540W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGuinea pig (Cavia porcellus)
CloneMO42540W
SpecificityThis antibody binds to Guinea pig Sgk1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels, suggesting an involvement in the regulation of processes such as cell survival, neuronal excitability, and renal sodium excretion. High levels of expression of this gene may contribute to conditions such as hypertension and diabetic nephropathy. Several alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
Product OverviewMouse Anti-Guinea pig Sgk1 Antibody is a mouse antibody against Sgk1. It can be used for Sgk1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSerum / glucocorticoid regulated kinase 1; Sgk1
UniProt IDC0L096
Protein RefseqThe length of the protein is87 amino acids long.
The sequence is show below: CGTPEYLAPEVLHKQPYDRAVDWWCLGAVMYEMLYGFPPFYSRNTAEMYDSILNKPPQLKPNITNSAGHLLEWLLQKDRTKRLGAKD.
For Research Use Only | Not For Clinical Use.
Online Inquiry