Mouse Anti-Rabbit SGK1 Antibody (MO-AB-09903Y)
Cat: MO-AB-09903Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rabbit (Oryctolagus cuniculus) |
Clone | MO09903Y |
Specificity | This antibody binds to Rabbit SGK1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Plasma membrane; Endoplasmic reticulum; Nucleus; Mitochondrion |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Serine/threonine-protein kinase which is involved in the regulation of a wide variety of ion channels, membrane transporters, cellular enzymes, transcription factors, neuronal excitability, cell growth, proliferation, survival, migration and apoptosis. Plays an important role in cellular stress response. Contributes to regulation of renal Na retention, renal K elimination, salt appetite, gastric acid secretion, intestinal Na/H exchange and nutrient transport, insulin-dependent salt sensitivity of blood pressure, salt sensitivity of peripheral glucose uptake, cardiac repolarization and memory consolidation. Up-regulates Na channels: SCNN1A/ENAC, SCN5A and ASIC1/ACCN2, K channels: KCNJ1/ROMK1, KCNA1-5, KCNQ1-5 and KCNE1, epithelial Ca channels: TRPV5 and TRPV6, chloride channels: BSND, CLCN2 and CFTR, glutamate transporters: SLC1A3/EAAT1, SLC1A2 /EAAT2, SLC1A1/EAAT3, SLC1A6/EAAT4 and SLC1A7/EAAT5, amino acid transporters: SLC1A5/ASCT2, SLC38A1/SN1 and SLC6A19, creatine transporter: SLC6A8, Na/dicarboxylate cotransporter: SLC13A2/NADC1, Na-dependent phosphate cotransporter: SLC34A2/NAPI-2B, glutamate receptor: GRIK2/GLUR6. Up-regulates carriers: SLC9A3/NHE3, SLC12A1/NKCC2, SLC12A3/NCC, SLC5A3/SMIT, SLC2A1/GLUT1, SLC5A1/SGLT1 and SLC15A2/PEPT2. Regulates enzymes: GSK3A/B, PMM2 and Na/K ATPase, and transcription factors: CTNNB1 and nuclear factor NF-kappa-B. Stimulates sodium transport into epithelial cells by enhancing the stability and expression of SCNN1A/ENAC. This is achieved by phosphorylating the NEDD4L ubiquitin E3 ligase, promoting its interaction with 14-3-3 proteins, thereby preventing it from binding to SCNN1A/ENAC and targeting it for degradation. Regulates store-operated Ca(+2) entry (SOCE) by stimulating ORAI1 and STIM1. Regulates KCNJ1/ROMK1 directly via its phosphorylation or indirectly via increased interaction with SLC9A3R2/NHERF2. Phosphorylates MDM2 and activates MDM2-dependent ubiquitination of p53/TP53. Phosphorylates MAPT/TAU and mediates microtubule depolymerization and neurite formation in hippocampal neurons. Phosphorylates SLC2A4/GLUT4 and up-regulates its activity. Phosphorylates APBB1/FE65 and promotes its localization to the nucleus. Phosphorylates MAPK1/ERK2 and activates it by enhancing its interaction with MAP2K1/MEK1 and MAP2K2/MEK2. Phosphorylates FBXW7 and plays an inhibitory role in the NOTCH1 signaling. Phosphorylates FOXO1 resulting in its relocalization from the nucleus to the cytoplasm. Phosphorylates FOXO3, promoting its exit from the nucleus and interference with FOXO3-dependent transcription. Phosphorylates BRAF and MAP3K3/MEKK3 and inhibits their activity. Phosphorylates SLC9A3/NHE3 in response to dexamethasone, resulting in its activation and increased localization at the cell membrane. Phosphorylates CREB1. Necessary for vascular remodeling during angiogenesis (By similarity). |
Product Overview | This product is a mouse antibody against SGK1. It can be used for SGK1 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Serine/threonine-protein kinase Sgk1; EC 2.7.11.1; Serum/glucocorticoid-regulated kinase 1; SGK1; SGK |
UniProt ID | Q9XT18 |
Protein Refseq | The length of the protein is 431 amino acids long. The sequence is show below: MTVKTEAARGPLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHTEVQSILKISQPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEAFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNGTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIRNHVFFSLINWDDLINKKITPPFNPNVSGPSDLRHFDPEFTEEPVPSSIGRSPDSILITASVKEAAEAFLGFSYAPPMDSFL. |
See other products for " SGK1 "
MO-AB-24734W | Mouse Anti-Chimpanzee SGK1 Antibody (MO-AB-24734W) |
MO-AB-42540W | Mouse Anti-Guinea pig Sgk1 Antibody (MO-AB-42540W) |
MO-AB-64266W | Mouse Anti-Marmoset SGK1 Antibody (MO-AB-64266W) |
MO-AB-20064R | Mouse Anti-Cattle SGK1 Antibody (MO-AB-20064R) |
CBMOAB-97947FYA | Mouse Anti-Zebrafish sgk1 Antibody (CBMOAB-97947FYA) |
MO-DKB-00768W | Rabbit Anti-SGK1 Antibody (MO-DKB-00768W) |
CBMOAB-09732HCB | Mouse Anti-C. elegans SGK1 Antibody (CBMOAB-09732HCB) |
MO-AB-33312W | Mouse Anti-Dog sgk1 Antibody (MO-AB-33312W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry