Mouse Anti-Elephant CCL5 Antibody (MO-AB-00188L)
Cat: MO-AB-00188L
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Elephant (Loxodonta africana) |
| Clone | MO00188L |
| Specificity | This antibody binds to Elephant CCL5. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Extracellular region or secreted |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | CCL5 (C-C Motif Chemokine Ligand 5) is a Protein Coding gene. Diseases associated with CCL5 include Ulcer Of Lower Limbs and Periapical Granuloma. Among its related pathways are PEDF Induced Signaling and Toll-like receptor signaling pathway. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and chemokine activity. An important paralog of this gene is CCL3L3. |
| Product Overview | This product is a mouse antibody against CCL5. It can be used for CCL5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | C-C Motif Chemokine Ligand 5; SIS-Delta; Regulated Upon Activation, Normally T-Expressed, And Presumably Secreted; Small Inducible Cytokine Subfamily A (Cys-Cys), Member 5; Eosinophil Chemotactic Cytokine; Chemokine (C-C Motif) Ligand 5; T-Cell Specific Protein P288; Beta-Chemokine RANTES; D17S136E; TCP228; SCYA5 |
| UniProt ID | G3TKK7 |
| Protein Refseq | The length of the protein is 91 amino acids long. The sequence is show below: MKVSAAALTVLVTAAALCVPASASPYASDTTPCCFAYTPRTLPHAHVKEYFYTSGKCSMPAVVFVTRRNRQVCADPEKKWVKEYINTLEMN. |
See other products for " CCL5 "
| MO-AB-09703R | Mouse Anti-Cattle CCL5 Antibody (MO-AB-09703R) |
| MOFY-0622-FY81 | Rabbit Anti-CCL5 Antibody (MOFY-0622-FY81) |
| MO-AB-19598W | Mouse Anti-Chimpanzee CCL5 Antibody (MO-AB-19598W) |
| CBMOAB-38550FYA | Mouse Anti-Rhesus CCL5 Antibody (CBMOAB-38550FYA) |
| MO-AB-07469Y | Mouse Anti-Rabbit CCL5 Antibody (MO-AB-07469Y) |
| MO-AB-41357W | Mouse Anti-Guinea pig CCL5 Antibody (MO-AB-41357W) |
| MOFY-0722-FY441 | FITC conjugated antibody to CCL5 Antibody (MOFY-0722-FY441) |
| MOFY-0622-FY9 | Mouse Anti-CCL5 Antibody (MOFY-0622-FY9) |
| MO-AB-34501W | Mouse Anti-Ferret CCL5 Antibody (MO-AB-34501W) |
| MOFY-0722-FY77 | Rabbit Anti-CCL5 Antibody (MOFY-0722-FY77) |
For Research Use Only | Not For Clinical Use.
Online Inquiry