Mouse Anti-Guinea pig CCL5 Antibody (MO-AB-41357W)


Cat: MO-AB-41357W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGuinea pig (Cavia porcellus)
CloneMO41357W
SpecificityThis antibody binds to Guinea pig CCL5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCCL5 (C-C Motif Chemokine Ligand 5) is a Protein Coding gene. Diseases associated with CCL5 include Ulcer Of Lower Limbs and Periapical Granuloma. Among its related pathways are PEDF Induced Signaling and Toll-like receptor signaling pathway. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and chemokine activity. An important paralog of this gene is CCL3L3.
Product OverviewMouse Anti-Guinea pig CCL5 Antibody is a mouse antibody against CCL5. It can be used for CCL5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC-C motif chemokine 5; SIS-delta; Small-inducible cytokine A5; T-cell-specific protein RANTES; CCL5; SCYA5
UniProt IDP97272
Protein RefseqThe length of the protein is91 amino acids long.
The sequence is show below: MKVSAAALCVILTTAALCVPASASPYASDTTPCCFAYISRALPRTHIKEYFYTSSKCSNLAVVFVTRKNRQVCANPEKKWVREYINSLEMS.
For Research Use Only | Not For Clinical Use.
Online Inquiry