Mouse Anti-Pig CCL5 Antibody (MO-AB-24390R)


Cat: MO-AB-24390R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO24390R
SpecificityThis antibody binds to Pig CCL5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCCL5 (C-C Motif Chemokine Ligand 5) is a Protein Coding gene. Diseases associated with CCL5 include Ulcer Of Lower Limbs and Periapical Granuloma. Among its related pathways are PEDF Induced Signaling and Toll-like receptor signaling pathway. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and chemokine activity. An important paralog of this gene is CCL3L3.
Product OverviewThis product is a mouse antibody against CCL5. It can be used for CCL5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC-C motif chemokine; CCL5
UniProt IDQ2EN89
Protein RefseqThe length of the protein is 91 amino acids long.
The sequence is show below: MKVSTAALAVILAMAALCAPASASPYASDTTPCCFSYLSRPLPRAHLQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINSLELS.
For Research Use Only | Not For Clinical Use.
Online Inquiry