Mouse Anti-Ferret ADSL Antibody (MO-AB-34341W)


Cat: MO-AB-34341W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFerret (Mustela Putorius Furo)
CloneMO34341W
SpecificityThis antibody binds to Ferret ADSL.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the lyase 1 family. It is an essential enzyme involved in purine metabolism, and catalyzes two non-sequential reactions in the de novo purine biosynthetic pathway: the conversion of succinylaminoimidazole carboxamide ribotide (SAICAR) to aminoimidazole carboxamide ribotide (AICAR) and the conversion of adenylosuccinate (S-AMP) to adenosine monophosphate (AMP). Mutations in this gene are associated with adenylosuccinase deficiency (ADSLD), a disorder marked with psychomotor retardation, epilepsy or autistic features. Alternatively spliced transcript variants have been found for this gene.
Product OverviewMouse Anti-Ferret ADSL Antibody is a mouse antibody against ADSL. It can be used for ADSL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdenylosuccinate lyase; ASL; EC 4.3.2.2; Adenylosuccinase; ADSL
UniProt IDM3YYC7
Protein RefseqThe length of the protein is 490 amino acids long.
The sequence is show below: MAESGDRGGQQAPCGYDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIQEMRSNLDNIDFKMAAEEEKQLRHDVMAHVHTFGHCCPKAAAIIHLGATSCYVGDNTDLIILRNAFDLLLPKLARVISRLADFAKERADLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEGDDQKVEQLDKMVTEKAGFKRAFIITGQTYTRKLDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMRSERCCSLARHLMTLIMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGNRQDCHEKIRVLSQQAAAVVKQEGGDNDLIERIQADAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYESVMKGGYFWTR.
For Research Use Only | Not For Clinical Use.
Online Inquiry