Mouse Anti-Frog cox5a Antibody (MO-AB-02597H)


Cat: MO-AB-02597H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO02597C
SpecificityThis antibody binds to Frog cox5a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCOX5A (Cytochrome C Oxidase Subunit 5A) is a Protein Coding gene. Diseases associated with COX5A include Mitochondrial Complex Iv Deficiency and Chronic Progressive External Ophthalmoplegia. Among its related pathways are Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. and Gene Expression. Gene Ontology (GO) annotations related to this gene include electron transfer activity and cytochrome-c oxidase activity.
Product OverviewThis product is a mouse antibody against cox5a. It can be used for cox5a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMGC79007 protein; cox5a; MGC79007
UniProt IDQ6IP26
Protein RefseqThe length of the protein is 148 amino acids long.
The sequence is show below: MLGAALLRRCVSSGLRSLPRCRLQSVSAGSPAAVAARCYSHAKHESDEEFDARWVTYFNKPDIDAWELRKGMNTLIGYDLVPEPKIIDAALRACRRLNDFASAVRILEAVKDKAGPHKEIYPYVIQELRPTLDELGISTPEELGLDKA.
See other products for " COX5A "
MO-AB-34620WMouse Anti-Ferret COX5A Antibody (MO-AB-34620W)
MO-AB-29870WMouse Anti-Dog COX5A Antibody (MO-AB-29870W)
MO-AB-10634RMouse Anti-Cattle COX5A Antibody (MO-AB-10634R)
CBMOAB-00827CRMouse Anti-Yeast COX5A Antibody (CBMOAB-00827CR)
MO-AB-11047YMouse Anti-O. mykiss COX5A Antibody (MO-AB-11047Y)
MO-AB-19778WMouse Anti-Chimpanzee COX5A Antibody (MO-AB-19778W)
MO-AB-25008HMouse Anti-Rat Cox5a Antibody (MO-AB-25008H)
CBMOAB-39761FYAMouse Anti-Rhesus COX5A Antibody (CBMOAB-39761FYA)
MO-DKB-00739WRabbit Anti-COX5A Antibody (MO-DKB-00739W)
MO-AB-53459WMouse Anti-Marmoset COX5A Antibody (MO-AB-53459W)
For Research Use Only | Not For Clinical Use.
Online Inquiry