Mouse Anti-Rhesus COX5A Antibody (CBMOAB-39761FYA)


Cat: CBMOAB-39761FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO39761FYA
SpecificityThis antibody binds to Rhesus COX5A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCOX5A (Cytochrome C Oxidase Subunit 5A) is a Protein Coding gene. Diseases associated with COX5A include Mitochondrial Complex Iv Deficiency and Chronic Progressive External Ophthalmoplegia. Among its related pathways are Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. and Gene Expression. Gene Ontology (GO) annotations related to this gene include electron transfer activity and cytochrome-c oxidase activity.
Product OverviewMouse Anti-Rhesus COX5A Antibody is a mouse antibody against COX5A. It can be used for COX5A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome c oxidase subunit 5A, mitochondrial; COX5A
UniProt IDF7HGR3
Protein RefseqThe length of the protein is 113 amino acids long.
The sequence is show below: MLGAALRRCAVAATTWAGPRGLLHSARTPGPAAAIQSVRCYSHGSHETDEEFDARWVTYFNKPDIDAWELRKGINTLVTYDLVPEPKIIDAALRACRRLNDFASTVRILEAVK.
For Research Use Only | Not For Clinical Use.
Online Inquiry