Mouse Anti-Yeast COX5A Antibody (CBMOAB-00827CR)
Cat: CBMOAB-00827CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Yeast |
Clone | MO00827CR |
Specificity | This antibody binds to Yeast COX5A. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Mitochondrion; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of COX2 and heme A of COX1 to the active site in COX1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix. |
Product Overview | Mouse Anti-Yeast COX5A Antibody is a mouse antibody against COX5A. It can be used for COX5A detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Cytochrome c oxidase polypeptide 5A, mitochondrial; EC 1.9.3.1; Cytochrome c oxidase polypeptide Va; COX5A; YNL052W |
UniProt ID | P00424 |
Protein Refseq | The length of the protein is 153 amino acids long. The sequence is show below: MLRNTFTRAGGLSRITSVRFAQTHALSNAAVMDLQSRWENMPSTEQQDIVSKLSERQKLPWAQLTEPEKQAVWYISYGEWGPRRPVLNKGDSSFIAKGVAAGLLFSVGLFAVVRMAGGQDAKTMNKEWQLKSDEYLKSKNANPWGGYSQVQSK. |
See other products for " cox5a "
MO-AB-02597H | Mouse Anti-Frog cox5a Antibody (MO-AB-02597H) |
MO-DKB-00739W | Rabbit Anti-COX5A Antibody (MO-DKB-00739W) |
MO-AB-25008H | Mouse Anti-Rat Cox5a Antibody (MO-AB-25008H) |
MO-AB-29870W | Mouse Anti-Dog COX5A Antibody (MO-AB-29870W) |
CBMOAB-39761FYA | Mouse Anti-Rhesus COX5A Antibody (CBMOAB-39761FYA) |
MO-AB-11047Y | Mouse Anti-O. mykiss COX5A Antibody (MO-AB-11047Y) |
MO-AB-34620W | Mouse Anti-Ferret COX5A Antibody (MO-AB-34620W) |
MO-AB-19778W | Mouse Anti-Chimpanzee COX5A Antibody (MO-AB-19778W) |
MO-AB-10634R | Mouse Anti-Cattle COX5A Antibody (MO-AB-10634R) |
MO-AB-53459W | Mouse Anti-Marmoset COX5A Antibody (MO-AB-53459W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry