Mouse Anti-GAD1 Antibody (CBMOAB-04222HCB)
Cat: CBMOAB-04222HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-04222HCB | Monoclonal | C. elegans (Caenorhabditis elegans), A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Dog (Canis lupus familiaris), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Yeast | WB, ELISA | MO04222HB | 100 µg | ||
CBMOAB-33667FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO33667FC | 100 µg | ||
CBMOAB-43299FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO43299FYA | 100 µg | ||
CBMOAB-01423CR | Monoclonal | Yeast | WB, ELISA | MO01423CR | 100 µg | ||
MO-AB-08098W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08098W | 100 µg | ||
MO-AB-30868W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO30868W | 100 µg | ||
MO-AB-55794W | Monoclonal | Marmoset | WB, ELISA | MO55794W | 100 µg | ||
MO-AB-25929H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25929C | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | C. elegans (Caenorhabditis elegans), A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Dog (Canis lupus familiaris), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Yeast |
Clone | MO04222HB |
Specificity | This antibody binds to C. elegans GAD1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantigen and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Deficiency in this enzyme has been shown to lead to pyridoxine dependency with seizures. Alternative splicing of this gene results in two products, the predominant 67-kD form and a less-frequent 25-kD form. |
Product Overview | Mouse Anti-C. elegans GAD1 Antibody is a mouse antibody against GAD1. It can be used for GAD1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Gastrulation defective protein 1; gad-1 |
UniProt ID | O16519 |
Protein Refseq | The length of the protein is 620 amino acids long. The sequence is show below: MDDNTAPKKNSEKKARVFDLQAMFAQTISNAPRTEEPTHVPQSVSVSSKSESGVSSSAVSDDEDDFMPDLPPGFQMQQSEAGPSSSRAEGPEDSDDSDFDETEAISIIKLIPAACEAKISHGTQAISALRVEPPGVRFASGGLDYYVKLFDFQKMDMSMRYDKELLPAESHVINSLAFSPNGETLVVASGEAIIRLLDRAGKQWSETVRGDQYIIDLNITKGHTATVNCVEFNPLNKNEFISCSDDGSLRLWNLDDHKVITKCINKHRKVIKTKGANGKRVSPQVCTFSPDGKWIAAGCDDGSVQAWKYGSQYVNVNYLVRKAHNGSITSIAFSPDSKRLLSRGFDDTLKMWSLDNPKEPLLVKTGLENAFKSTDCGFSPRAEVVFTGTSSPNKDTPGTLQFFDPMTFDLVYKIDYPGISCHRIQWHPRLNQIIAGLSDGTIHVYYDQTMSQRGVMSCVTKPLKRNRASEVVREDMVLSPLSLEMFQPRGEEGEEKEVTGWRIKKYLRMQDNKLRPEFRKPADMPINGKSANGRVAASGGSLHSYLAKQIGTARNAEFLKDTDVRASILKHAKDAEENPLYIDKAYRKTQPKKIFQETAVEPEDQDDEELQPVFKMPRTK. |
See other products for " gad1 "
MO-AB-41682W | Mouse Anti-gad1 Antibody (MO-AB-41682W) |
MO-NAB-00385W | Mouse Anti-GAD1 Antibody (Full-length) |
CBMOAB-17143FYA | Mouse Anti-Gad1 Antibody (CBMOAB-17143FYA) |
MO-AB-12835R | Mouse Anti-GAD1 Antibody (MO-AB-12835R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry