Mouse Anti-Goat PCSK1 Antibody (MO-AB-37936W)
Cat: MO-AB-37936W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Goat (Capra hircus) |
| Clone | MO37936W |
| Specificity | This antibody binds to Goat PCSK1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an initial autocatalytic processing event in the ER to generate a heterodimer which exits the ER and sorts to subcellular compartments where a second autocatalytic even takes place and the catalytic activity is acquired. The protease is packaged into and activated in dense core secretory granules and expressed in the neuroendocrine system and brain. This gene encodes one of the seven basic amino acid-specific members which cleave their substrates at single or paired basic residues. It functions in the proteolytic activation of polypeptide hormones and neuropeptides precursors. Mutations in this gene have been associated with susceptibility to obesity and proprotein convertase 1/3 deficiency. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene [provided by RefSeq, Jan 2014] |
| Product Overview | Mouse Anti-Goat PCSK1 Antibody is a mouse antibody against PCSK1. It can be used for PCSK1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Proprotein convertase subtilisin / kexin type 1; PCSK1 |
| UniProt ID | D8V3M0 |
| Protein Refseq | The length of the protein is 71 amino acids long. The sequence is show below: GRQGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDYTDQRI. |
See other products for " pcsk1 "
| CBMOAB-91898FYA | Mouse Anti-Zebrafish pcsk1 Antibody (CBMOAB-91898FYA) |
| MO-AB-28163R | Mouse Anti-Pig PCSK1 Antibody (MO-AB-28163R) |
| MO-AB-16741W | Mouse Anti-Chimpanzee PCSK1 Antibody (MO-AB-16741W) |
| MO-DKB-03375W | Rabbit Anti-PCSK1 (Center) Antibody (Cat MO-DKB-03375W) |
| CBMOAB-54056FYA | Mouse Anti-Rhesus PCSK1 Antibody (CBMOAB-54056FYA) |
| MO-AB-61144W | Mouse Anti-Marmoset PCSK1 Antibody (MO-AB-61144W) |
| MO-AB-17640R | Mouse Anti-Cattle PCSK1 Antibody (MO-AB-17640R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry