Mouse Anti-Goat Tg Antibody (MO-AB-38271W)


Cat: MO-AB-38271W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGoat (Capra hircus)
CloneMO38271W
SpecificityThis antibody binds to Goat Tg.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThyroglobulin (Tg) is a glycoprotein homodimer produced predominantly by the thryroid gland. It acts as a substrate for the synthesis of thyroxine and triiodothyronine as well as the storage of the inactive forms of thyroid hormone and iodine. Thyroglobulin is secreted from the endoplasmic reticulum to its site of iodination, and subsequent thyroxine biosynthesis, in the follicular lumen. Mutations in this gene cause thyroid dyshormonogenesis, manifested as goiter, and are associated with moderate to severe congenital hypothyroidism. Polymorphisms in this gene are associated with susceptibility to autoimmune thyroid diseases (AITD) such as Graves disease and Hashimoto thryoiditis.
Product OverviewMouse Anti-Goat Tg Antibody is a mouse antibody against Tg. It can be used for Tg detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesThyroglobulin; Tg
UniProt IDQ9MYK5
Protein RefseqThe length of the protein is 132 amino acids long.
The sequence is show below: CSPDGAFRPVQCKFVNTTDMMIFDLVHSYNRFPDAFVTFSSFRSRFPEVSGYCYCADSQGRELAETGLELLLDEIYDTIFAGLDLASTFAETTLYRILQRRFLAVQLVISGRFRCPTKCEVERFAATRFHHP.
For Research Use Only | Not For Clinical Use.
Online Inquiry