Mouse Anti-Gorilla ADRB2 Antibody (MO-AB-38426W)
Cat: MO-AB-38426W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Gorilla |
Clone | MO38426W |
Specificity | This antibody binds to Gorilla ADRB2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes beta-2-adrenergic receptor which is a member of the G protein-coupled receptor superfamily. This receptor is directly associated with one of its ultimate effectors, the class C L-type calcium channel Ca(V)1.2. This receptor-channel complex also contains a G protein, an adenylyl cyclase, cAMP-dependent kinase, and the counterbalancing phosphatase, PP2A. The assembly of the signaling complex provides a mechanism that ensures specific and rapid signaling by this G protein-coupled receptor. This gene is intronless. Different polymorphic forms, point mutations, and/or downregulation of this gene are associated with nocturnal asthma, obesity and type 2 diabetes. |
Product Overview | Mouse Anti-Gorilla ADRB2 Antibody is a mouse antibody against ADRB2. It can be used for ADRB2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Beta2 adrenergic receptor; ADRB2 |
UniProt ID | K0IUY8 |
Protein Refseq | The length of the protein is 67 amino acids long. The sequence is show below: MGQPGNGSAFLLAPNGSHAPDHDVTQERDEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTV. |
See other products for " ADRB2 "
CBMOAB-00299FYA | Rabbit Anti-Mouse ADRB2 Antibody (CBMOAB-00299FYA) |
MO-DKB-01103W | Rabbit Anti-ADRB2 Antibody (MO-DKB-01103W) |
CBMOAB-35268FYA | Mouse Anti-Rhesus ADRB2 Antibody (CBMOAB-35268FYA) |
MO-AB-00019L | Mouse Anti-Elephant ADRB2 Antibody (MO-AB-00019L) |
MO-AB-18168W | Mouse Anti-Chimpanzee ADRB2 Antibody (MO-AB-18168W) |
MOFY-1222-FY94 | Rabbit Anti-ADRB2 Antibody (MOFY-1222-FY94) |
MO-AB-42908W | Mouse Anti-Hamsters ADRB2 Antibody (MO-AB-42908W) |
MO-AB-28856W | Mouse Anti-Dog ADRB2 Antibody (MO-AB-28856W) |
MO-AB-23591R | Mouse Anti-Pig ADRB2 Antibody (MO-AB-23591R) |
MO-AB-01278H | Mouse Anti-Frog adrb2 Antibody (MO-AB-01278H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry