Mouse Anti-Gorilla ADRB2 Antibody (MO-AB-38426W)


Cat: MO-AB-38426W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGorilla
CloneMO38426W
SpecificityThis antibody binds to Gorilla ADRB2.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes beta-2-adrenergic receptor which is a member of the G protein-coupled receptor superfamily. This receptor is directly associated with one of its ultimate effectors, the class C L-type calcium channel Ca(V)1.2. This receptor-channel complex also contains a G protein, an adenylyl cyclase, cAMP-dependent kinase, and the counterbalancing phosphatase, PP2A. The assembly of the signaling complex provides a mechanism that ensures specific and rapid signaling by this G protein-coupled receptor. This gene is intronless. Different polymorphic forms, point mutations, and/or downregulation of this gene are associated with nocturnal asthma, obesity and type 2 diabetes.
Product OverviewMouse Anti-Gorilla ADRB2 (clone MO38426W) Antibody (MO-AB-38426W) is a mouse antibody against ADRB2. It can be used for ADRB2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBeta2 adrenergic receptor; ADRB2
UniProt IDK0IUY8
Protein RefseqThe length of the protein is 67 amino acids long.
The sequence is show below: MGQPGNGSAFLLAPNGSHAPDHDVTQERDEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTV.
For Research Use Only | Not For Clinical Use.

Online Inquiry