Mouse Anti-Guinea pig B2M Antibody (MO-AB-41307W)


Cat: MO-AB-41307W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGuinea pig (Cavia porcellus)
CloneMO41307W
SpecificityThis antibody binds to Guinea pig B2M.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Plasma membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fibrils in some pathological conditions. The encoded antimicrobial protein displays antibacterial activity in amniotic fluid. A mutation in this gene has been shown to result in hypercatabolic hypoproteinemia.B2M (Beta-2-Microglobulin) is a Protein Coding gene. Diseases associated with B2M include Immunodeficiency 43 and Amyloidosis, Familial Visceral. Among its related pathways are Cytokine Signaling in Immune system and Innate Immune System. Gene Ontology (GO) annotations related to this gene include identical protein binding.Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system. Exogenously applied M.tuberculosis EsxA or EsxA-EsxB (or EsxA expressed in host) binds B2M and decreases its export to the cell surface (total protein levels do not change), probably leading to defects in class I antigen presentation (PubMed:25356553).
Product OverviewMouse Anti-Guinea pig B2M Antibody is a mouse antibody against B2M. It can be used for B2M detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBeta-2-microglobulin; B2M
UniProt IDP01886
Protein RefseqThe length of the protein is99 amino acids long.
The sequence is show below: VLHAPRVQVYSRHPAENGKQNFINCYVSGFHPPQIEVELLKNGKKIDNVEMSDLSFSKDWTFYLLVHAAFTPNDSDEYSCRVSHITLSEPKIVKWDPNK.
For Research Use Only | Not For Clinical Use.
Online Inquiry