Mouse Anti-Mallard b2m Antibody (MO-AB-22989H)
Cat: MO-AB-22989H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Mallard (Anas platyrhynchos) |
Clone | MO22989C |
Specificity | This antibody binds to Mallard b2m. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted; Plasma membrane |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fibrils in some pathological conditions. The encoded antimicrobial protein displays antibacterial activity in amniotic fluid. A mutation in this gene has been shown to result in hypercatabolic hypoproteinemia.B2M (Beta-2-Microglobulin) is a Protein Coding gene. Diseases associated with B2M include Immunodeficiency 43 and Amyloidosis, Familial Visceral. Among its related pathways are Cytokine Signaling in Immune system and Innate Immune System. Gene Ontology (GO) annotations related to this gene include identical protein binding.Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system. Exogenously applied M.tuberculosis EsxA or EsxA-EsxB (or EsxA expressed in host) binds B2M and decreases its export to the cell surface (total protein levels do not change), probably leading to defects in class I antigen presentation. |
Product Overview | This product is a mouse antibody against b2m. It can be used for b2m detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Beta-2-microglobulin; b2m |
UniProt ID | Q14U75 |
Protein Refseq | The length of the protein is 119 amino acids long. The sequence is show below: MAKAAIVALVALVALLGQGQAKAAPKVQVYSRHPATAGTENILNCYVEGFHPPKIDIALLKNGEPMKDVKYNDMSFGDDWTFQRLVYAPFTPTKSDVYTCRVDHEAFTEPQSFRWEPDF. |
See other products for " B2M "
MO-AB-14331Y | Mouse Anti-Sheep B2M Antibody (MO-AB-14331Y) |
MO-AB-34163W | Mouse Anti-Donkey B2M Antibody (MO-AB-34163W) |
MO-AB-41307W | Mouse Anti-Guinea pig B2M Antibody (MO-AB-41307W) |
CBMOAB-36686FYA | Mouse Anti-Rhesus B2M Antibody (CBMOAB-36686FYA) |
MO-AB-34450W | Mouse Anti-Ferret B2M Antibody (MO-AB-34450W) |
MO-AB-43834W | Mouse Anti-Horse B2M Antibody (MO-AB-43834W) |
MO-AB-42954W | Mouse Anti-Hamsters B2M Antibody (MO-AB-42954W) |
MO-AB-24306H | Mouse Anti-Rat B2m Antibody (MO-AB-24306H) |
MOFY-1222-FY240 | Rabbit Anti-b2m Antibody (MOFY-1222-FY240) |
MOFY-0722-FY428 | Rabbit Anti-b2M Antibody (MOFY-0722-FY428) |
For Research Use Only | Not For Clinical Use.
Online Inquiry