Mouse Anti-Guinea pig SUMO2 Antibody (MO-AB-42660W)
Cat: MO-AB-42660W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Guinea pig (Cavia porcellus) |
Clone | MO42660W |
Specificity | This antibody binds to Guinea pig SUMO2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Ubiquitin-like protein that can be covalently attached to proteins as a monomer or as a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Polymeric SUMO2 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. Plays a role in the regulation of sumoylation status of SETX (By similarity). |
Product Overview | Mouse Anti-Guinea pig SUMO2 Antibody is a mouse antibody against SUMO2. It can be used for SUMO2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Small ubiquitin-related modifier; SUMO; SUMO4 |
UniProt ID | H0WCS2 |
Protein Refseq | The length of the protein is95 amino acids long. The sequence is show below: MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY. |
See other products for " SUMO2 "
MO-AB-23770H | Mouse Anti-Mallard SUMO2 Antibody (MO-AB-23770H) |
MO-AB-65658W | Mouse Anti-Marmoset SUMO2 Antibody (MO-AB-65658W) |
MO-AB-29286H | Mouse Anti-Rat Sumo2 Antibody (MO-AB-29286H) |
MO-NAB-00861W | Mouse Anti-SUMO2 Antibody (AA 57-66) |
CBMOAB-59448FYA | Mouse Anti-Rhesus SUMO2 Antibody (CBMOAB-59448FYA) |
CBMOAB-41933FYC | Mouse Anti-Arabidopsis SUMO2 Antibody (CBMOAB-41933FYC) |
MO-AB-33866H | Mouse Anti-Nile tilapia sumo2 Antibody (MO-AB-33866H) |
MO-AB-33595W | Mouse Anti-Dog SUMO2 Antibody (MO-AB-33595W) |
MO-AB-10144Y | Mouse Anti-Rabbit SUMO2 Antibody (MO-AB-10144Y) |
MO-AB-43464W | Mouse Anti-Hamsters SUMO2 Antibody (MO-AB-43464W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry