Mouse Anti-Mallard SUMO2 Antibody (MO-AB-23770H)
Cat: MO-AB-23770H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Mallard (Anas platyrhynchos) |
Clone | MO23770C |
Specificity | This antibody binds to Mallard SUMO2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Ubiquitin-like protein that can be covalently attached to proteins as a monomer or as a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Polymeric SUMO2 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. Plays a role in the regulation of sumoylation status of SETX (By similarity). |
Product Overview | This product is a mouse antibody against SUMO2. It can be used for SUMO2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Small ubiquitin-related modifier; SUMO; SUMO2 |
UniProt ID | U3IGN8 |
Protein Refseq | The length of the protein is 89 amino acids long. The sequence is show below: QEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY. |
See other products for " SUMO2 "
MO-NAB-00861W | Mouse Anti-SUMO2 Antibody (AA 57-66) |
MO-AB-10144Y | Mouse Anti-Rabbit SUMO2 Antibody (MO-AB-10144Y) |
MO-DKB-02511W | Rabbit Anti-SUMO2 Antibody (MO-DKB-02511W) |
MO-AB-42660W | Mouse Anti-Guinea pig SUMO2 Antibody (MO-AB-42660W) |
CBMOAB-41933FYC | Mouse Anti-Arabidopsis SUMO2 Antibody (CBMOAB-41933FYC) |
MO-AB-01700R | Mouse Anti-Medaka SUMO2 Antibody (MO-AB-01700R) |
MO-AB-13358Y | Mouse Anti-O. mykiss SUMO2 Antibody (MO-AB-13358Y) |
MO-AB-01481L | Mouse Anti-Elephant SUMO2 Antibody (MO-AB-01481L) |
MO-AB-33866H | Mouse Anti-Nile tilapia sumo2 Antibody (MO-AB-33866H) |
MO-AB-65658W | Mouse Anti-Marmoset SUMO2 Antibody (MO-AB-65658W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry