Mouse Anti-Horse HIF1A Antibody (MO-AB-45028W)


Cat: MO-AB-45028W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO45028W
SpecificityThis antibody binds to Horse HIF1A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes the alpha subunit of transcription factor hypoxia-inducible factor-1 (HIF-1), which is a heterodimer composed of an alpha and a beta subunit. HIF-1 functions as a master regulator of cellular and systemic homeostatic response to hypoxia by activating transcription of many genes, including those involved in energy metabolism, angiogenesis, apoptosis, and other genes whose protein products increase oxygen delivery or facilitate metabolic adaptation to hypoxia. HIF-1 thus plays an essential role in embryonic vascularization, tumor angiogenesis and pathophysiology of ischemic disease. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.
Product OverviewMouse Anti-Horse HIF1A Antibody is a mouse antibody against HIF1A. It can be used for HIF1A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHypoxia-inducible factor 1-alpha-like protein; HIF1A
UniProt IDL7MRM7
Protein RefseqThe length of the protein is156 amino acids long.
The sequence is show below: RAGKGVIEQTEKSHPRSPNVLSVTLSQRTAVPEEELNPKILALQNAQRKRKIEHDGSLFQAVGIGALLQQPDDRATTTSLSWKRIKGCKSSEQNGMEQKTTILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN.
For Research Use Only | Not For Clinical Use.
Online Inquiry