Mouse Anti-Horse SNCA Antibody (MO-AB-46625W)


Cat: MO-AB-46625W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO46625W
SpecificityThis antibody binds to Horse SNCA.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAlpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene.
Product OverviewMouse Anti-Horse SNCA Antibody is a mouse antibody against SNCA. It can be used for SNCA detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAlpha-synuclein; SNCA
UniProt IDF6U044
Protein RefseqThe length of the protein is140 amino acids long.
The sequence is show below: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGEAVVTGVTAVAQKTVEGAESIAAATGFGKKDHLGKSEEGAAQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA.
For Research Use Only | Not For Clinical Use.
Online Inquiry