Mouse Anti-Pig SNCA Antibody (MO-AB-30270R)
Cat: MO-AB-30270R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Pig (Sus scrofa) |
Clone | MO30270R |
Specificity | This antibody binds to Pig SNCA. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer''s disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene. |
Product Overview | This product is a mouse antibody against SNCA. It can be used for SNCA detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Alpha-synuclein, Fragment; SNCA |
UniProt ID | Q4PNS0 |
Protein Refseq | The length of the protein is 38 amino acids long. The sequence is show below: NEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA. |
See other products for " SNCA "
MO-AB-15465W | Mouse Anti-Chimpanzee SNCA Antibody (MO-AB-15465W) |
MO-AB-23751H | Mouse Anti-Mallard SNCA Antibody (MO-AB-23751H) |
MO-AB-20652R | Mouse Anti-Cattle SNCA Antibody (MO-AB-20652R) |
MO-AB-46625W | Mouse Anti-Horse SNCA Antibody (MO-AB-46625W) |
MO-AB-42614W | Mouse Anti-Guinea pig SNCA Antibody (MO-AB-42614W) |
MO-AB-01627R | Mouse Anti-Medaka SNCA Antibody (MO-AB-01627R) |
MO-AB-08238W | Mouse Anti-Cat SNCA Antibody (MO-AB-08238W) |
MO-AB-04073Y | Mouse Anti-Chicken SNCA Antibody (MO-AB-04073Y) |
MO-AB-01433L | Mouse Anti-Elephant SNCA Antibody (MO-AB-01433L) |
MO-AB-17739Y | Mouse Anti-Sheep SNCA Antibody (MO-AB-17739Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry