AibGenesis™ Mouse Anti-IL15 Antibody (CBMOAB-45255FYA)
Cat: CBMOAB-45255FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
- Reference
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-45255FYA | Monoclonal | Rhesus (Macaca mulatta), Bovine, Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig, Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), O. anatinus (Ornithorhynchus anatinus), O. mykiss (Oncorhynchus mykiss), Ovis aries, Sheep, Pig (Sus scrofa), Rabbit, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO45255FYA | 100 µg | ||
| CBMOAB-80606FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO80606FYA | 100 µg | ||
| MO-AB-08980W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08980W | 100 µg | ||
| MO-AB-31259W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO31259W | 100 µg | ||
| MO-AB-34955W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34955W | 100 µg | ||
| MO-AB-41866W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41866W | 100 µg | ||
| MO-AB-45128W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO45128W | 100 µg | ||
| MO-AB-14108R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO14108R | 100 µg | ||
| MO-AB-26637R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO26637R | 100 µg | ||
| MO-AB-23314H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23314C | 100 µg | ||
| MO-AB-26478H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO26478C | 100 µg | ||
| MO-AB-00658L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00658L | 100 µg | ||
| MO-AB-06574Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06574Y | 100 µg | ||
| MO-AB-08464Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08464Y | 100 µg | ||
| MO-AB-11810Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO11810Y | 100 µg | ||
| MO-AB-15756Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15756Y | 100 µg | ||
| MOFY-0622-FY114 | Polyclonal | Ovis aries, Sheep | WB, IHC, ICC | 100 µg | |||
| MOFY-0622-FY164 | Polyclonal | Guinea pig | WB, IHC, ICC, IP | 100 µg | |||
| MOFY-0622-FY216 | Polyclonal | Rabbit | WB, IHC, ICC, IP | 100 µg | |||
| MOFY-0722-FY359 | Polyclonal | Bovine | WB, IHC, ICC, IP | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Bovine, Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig, Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), O. anatinus (Ornithorhynchus anatinus), O. mykiss (Oncorhynchus mykiss), Ovis aries, Sheep, Pig (Sus scrofa), Rabbit, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
| Clone | MO45255FYA |
| Specificity | This antibody binds to Rhesus IL15. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may compete for the same receptor, and thus negatively regulate each other's activity. The number of CD8+ memory cells is shown to be controlled by a balance between this cytokine and IL2. This cytokine induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. Studies of the mouse counterpart suggested that this cytokine may increase the expression of apoptosis inhibitor BCL2L1/BCL-x(L), possibly through the transcription activation activity of STAT6, and thus prevent apoptosis. Alternatively spliced transcript variants of this gene have been reported. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus IL15 Antibody is a mouse antibody against IL15. It can be used for IL15 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Interleukin; IL15 |
| UniProt ID | G1K380 |
| Protein Refseq | The length of the protein is 161 amino acids long. The sequence is show below: IFQKPHLRSVSIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISHESGDTDIHDTVENLIILANNILSSNGNITESGCKECEELEEKNIKEFLQSFVHIVQMFINTS. |
Reference
| Reference | 1. DeGottardi, M. Q., Okoye, A. A., Vaidya, M., Talla, A., Konfe, A. L., Reyes, M. D., ... & Picker, L. J. (2016). Effect of anti-IL-15 administration on T cell and NK cell homeostasis in rhesus macaques. The Journal of Immunology, 197(4), 1183-1198. 2. Waldmann, T. A., Lugli, E., Roederer, M., Perera, L. P., Smedley, J. V., Macallister, R. P., ... & Creekmore, S. P. (2011). Safety (toxicity), pharmacokinetics, immunogenicity, and impact on elements of the normal immune system of recombinant human IL-15 in rhesus macaques. Blood, the Journal of the American Society of Hematology, 117(18), 4787-4795. |
See other products for " IL15 "
For Research Use Only | Not For Clinical Use.
Online Inquiry