AibGenesis™ Mouse Anti-IL15 Antibody (MO-AB-22645W)
Cat: MO-AB-22645W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
- Reference
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-22645W | Monoclonal | Chimpanzee (Pan troglodytes), Bovine, Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig, Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), O. anatinus (Ornithorhynchus anatinus), O. mykiss (Oncorhynchus mykiss), Ovis aries, Sheep, Pig (Sus scrofa), Rabbit, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO22645W | 100 µg | ||
| CBMOAB-80606FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO80606FYA | 100 µg | ||
| MO-AB-08980W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08980W | 100 µg | ||
| MO-AB-31259W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO31259W | 100 µg | ||
| MO-AB-34955W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34955W | 100 µg | ||
| MO-AB-41866W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41866W | 100 µg | ||
| MO-AB-45128W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO45128W | 100 µg | ||
| MO-AB-14108R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO14108R | 100 µg | ||
| MO-AB-26637R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO26637R | 100 µg | ||
| MO-AB-23314H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23314C | 100 µg | ||
| MO-AB-26478H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO26478C | 100 µg | ||
| MO-AB-00658L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00658L | 100 µg | ||
| MO-AB-06574Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06574Y | 100 µg | ||
| MO-AB-08464Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08464Y | 100 µg | ||
| MO-AB-11810Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO11810Y | 100 µg | ||
| MO-AB-15756Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15756Y | 100 µg | ||
| MOFY-0622-FY114 | Polyclonal | Ovis aries, Sheep | WB, IHC, ICC | 100 µg | |||
| MOFY-0622-FY164 | Polyclonal | Guinea pig | WB, IHC, ICC, IP | 100 µg | |||
| MOFY-0622-FY216 | Polyclonal | Rabbit | WB, IHC, ICC, IP | 100 µg | |||
| MOFY-0722-FY359 | Polyclonal | Bovine | WB, IHC, ICC, IP | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Chimpanzee (Pan troglodytes), Bovine, Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig, Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), O. anatinus (Ornithorhynchus anatinus), O. mykiss (Oncorhynchus mykiss), Ovis aries, Sheep, Pig (Sus scrofa), Rabbit, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
| Clone | MO22645W |
| Specificity | This antibody binds to Chimpanzee IL15. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Extracellular region or secreted |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Chimpanzee IL15 Antibody is a mouse antibody against IL15. It can be used for IL15 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Interleukin; IL15 |
| UniProt ID | H2QQ76 |
| Protein Refseq | The length of the protein is 162 amino acids long. The sequence is show below: MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS. |
Reference
| Reference | 1. Rodriguez, A. R., Arulanandam, B. P., Hodara, V. L., McClure, H. M., Cobb, E. K., Salas, M. T., ... & Murthy, K. K. (2007). Influence of interleukin-15 on CD8+ natural killer cells in human immunodeficiency virus type 1-infected chimpanzees. Journal of general virology, 88(2), 641-651. 2. Rodriguez, A. R., Hodara, V., Murthy, K., Morrow, L., Sanchez, M., Bienvenu, A. E., & Murthy, K. K. (2014). T cell interleukin-15 surface expression in chimpanzees infected with human immunodeficiency virus. Cellular immunology, 288(1-2), 24-30. 3. Rodriguez, A. R., Hodara, V. L., Morrow, L., Sanchez, M., Knudsvig, T., & Murthy, K. K. (2007). Interleukin-15: Multiple roles in controlling HIV infection in chimpanzees (B143). The Journal of Immunology, 178(1_Supplement), LB30-LB30. |
See other products for " IL15 "
| MO-AB-02461Y | AibGenesis™ Mouse Anti-IL15 Antibody (MO-AB-02461Y) |
| MO-AB-57195W | AibGenesis™ Mouse Anti-IL15 Antibody (MO-AB-57195W) |
| CBMOAB-45255FYA | AibGenesis™ Mouse Anti-IL15 Antibody (CBMOAB-45255FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry