AibGenesis™ Mouse Anti-IL15 Antibody (MO-AB-02461Y)


Cat: MO-AB-02461Y

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
  • Reference
  • Relate Reference Data
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-02461Y Monoclonal Chicken (Gallus gallus), Bovine, Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig, Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), O. anatinus (Ornithorhynchus anatinus), O. mykiss (Oncorhynchus mykiss), Ovis aries, Sheep, Pig (Sus scrofa), Rabbit, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO02461Y 100 µg
CBMOAB-80606FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO80606FYA 100 µg
MO-AB-08980W Monoclonal Cat (Felis catus) WB, ELISA MO08980W 100 µg
MO-AB-31259W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31259W 100 µg
MO-AB-34955W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34955W 100 µg
MO-AB-41866W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41866W 100 µg
MO-AB-45128W Monoclonal Horse (Equus caballus) WB, ELISA MO45128W 100 µg
MO-AB-14108R Monoclonal Cattle (Bos taurus) WB, ELISA MO14108R 100 µg
MO-AB-26637R Monoclonal Pig (Sus scrofa) WB, ELISA MO26637R 100 µg
MO-AB-23314H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23314C 100 µg
MO-AB-26478H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26478C 100 µg
MO-AB-00658L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00658L 100 µg
MO-AB-06574Y Monoclonal O. anatinus (Ornithorhynchus anatinus) WB, ELISA MO06574Y 100 µg
MO-AB-08464Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08464Y 100 µg
MO-AB-11810Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO11810Y 100 µg
MO-AB-15756Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15756Y 100 µg
MOFY-0622-FY114 Polyclonal Ovis aries, Sheep WB, IHC, ICC 100 µg
MOFY-0622-FY164 Polyclonal Guinea pig WB, IHC, ICC, IP 100 µg
MOFY-0622-FY216 Polyclonal Rabbit WB, IHC, ICC, IP 100 µg
MOFY-0722-FY359 Polyclonal Bovine WB, IHC, ICC, IP 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChicken (Gallus gallus), Bovine, Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig, Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), O. anatinus (Ornithorhynchus anatinus), O. mykiss (Oncorhynchus mykiss), Ovis aries, Sheep, Pig (Sus scrofa), Rabbit, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO02461Y
SpecificityThis antibody binds to Chicken IL15.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may compete for the same receptor, and thus negatively regulate each other''s activity. The number of CD8+ memory cells is shown to be controlled by a balance between this cytokine and IL2. This cytokine induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. Studies of the mouse counterpart suggested that this cytokine may increase the expression of apoptosis inhibitor BCL2L1/BCL-x(L), possibly through the transcription activation activity of STAT6, and thus prevent apoptosis. Alternatively spliced transcript variants of this gene have been reported. [provided by RefSeq, Feb 2011] (From NCBI)
Product OverviewThis product is a mouse antibody against IL15. It can be used for IL15 detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesInterleukin; IL-15
UniProt IDQ9DEV5
Protein RefseqThe length of the protein is 187 amino acids long. The sequence is show below: MLGMAQPTQNSAGARRRPESQKTHVKSICLQYQLYLLLNSHFFCLLKNKTGLTIFFLCAYVPKTEANHCKWSDVLKDLELIKTSEDIDVSLYTANTYEDIECQEPVMRCFFLEMKVILHECGIKKCSRKHDVWNILKNGNARFATYQLNSTTSKKCKECEEYEEKNFTEFIQSFVKVIQRECKKYAN.

Reference

Reference1. Lillehoj, H. S., Min, W., Choi, K. D., Babu, U. S., Burnside, J., Miyamoto, T., ... & Lillehoj, E. P. (2001). Molecular, cellular, and functional characterization of chicken cytokines homologous to mammalian IL-15 and IL-2. Veterinary immunology and immunopathology, 82(3-4), 229-244.
2. Lim, K. L., Jazayeri, S. D., Yeap, S. K., Alitheen, N. B. M., Bejo, M. H., Ideris, A., & Omar, A. R. (2012). Co-administration of avian influenza virus H5 plasmid DNA with chicken IL-15 and IL-18 enhanced chickens immune responses. BMC veterinary research, 8(1), 1-14.

Relate Reference Data

Figure 1 PCR amplification of H5 gene from pCR2.1 vector and IL-15 and IL-18 genes from pgm2n.pk009.p17 and pgm2n.pk010.c11, respectively. Lane 1: IL-15 gene (564 bp); Lane 2: IL-18 gene (486 bp).

For Research Use Only | Not For Clinical Use.
Online Inquiry