Mouse Anti-Mallard RHO Antibody (MO-AB-23677H)


Cat: MO-AB-23677H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMallard (Anas platyrhynchos)
CloneMO23677C
SpecificityThis antibody binds to Mallard RHO.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Plasma membrane; Golgi apparatus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is found in rod cells in the back of the eye and is essential for vision in low-light conditions. The encoded protein binds to 11-cis retinal and is activated when light hits the retinal molecule. Defects in this gene are a cause of congenital stationary night blindness.
Product OverviewThis product is a mouse antibody against RHO. It can be used for RHO detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRhodopsin; RHO
UniProt IDU3IBZ9
Protein RefseqThe length of the protein is 351 amino acids long.
The sequence is show below: MNGTEGQDFYVPMSNKTGVVRSPFEYPQYYLAEPWKFSALAAYMFMLILLGFPINFLTLYVTIQHKKLRTPLNYILLNLAVADLFMVFGGFTTTMYTSMNGYFVFGVTGCYIEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVVFTWIMALACAAPPLFGWSRYIPEGMQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPLMVIFFCYGNLVCTVKEAAAQQQESATTQKAEKEVTRMVIIMVIAFLICWVPYASVAFYIFTNQGSDFGPIFMTIPAFFAKSSAIYNPVIYIVMNKQFRNCMITTLCCGKNPLGDEDTSAGKTETSSVSTSQVSPA.
For Research Use Only | Not For Clinical Use.
Online Inquiry