Mouse Anti-Marmoset ACP1 Antibody (MO-AB-50341W)


Cat: MO-AB-50341W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO50341W
SpecificityThis antibody binds to Marmoset ACP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe product of this gene belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. This gene is genetically polymorphic, and three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.
Product OverviewMouse Anti-Marmoset ACP1 Antibody is a mouse antibody against ACP1. It can be used for ACP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLow molecular weight phosphotyrosine protein phosphatase isoform c; ACP1
UniProt IDU3CJJ6
Protein RefseqThe length of the protein is 158 amino acids long.
The sequence is show below: MAEPAAKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQNCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFEAVYQQCVRCCRAFLEKDH.
For Research Use Only | Not For Clinical Use.
Online Inquiry