Mouse Anti-Marmoset CLNS1A Antibody (MO-AB-53178W)


Cat: MO-AB-53178W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO53178W
SpecificityThis antibody binds to Marmoset CLNS1A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Cytosol; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that functions in multiple regulatory pathways. The encoded protein complexes with numerous cytosolic proteins and performs diverse functions including regulation of small nuclear ribonucleoprotein biosynthesis, platelet activation and cytoskeletal organization. The protein is also found associated with the plasma membrane where it functions as a chloride current regulator. Pseudogenes of this gene are found on chromosomes 1, 4 and 6. Several transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Marmoset CLNS1A Antibody is a mouse antibody against CLNS1A. It can be used for CLNS1A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMethylosome subunit pICln; CLNS1A
UniProt IDF7EM43
Protein RefseqThe length of the protein is 237 amino acids long.
The sequence is show below: MSFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDRSDCLGEHLYVMVNAKFEEESKESVADEEEEDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH.
See other products for " CLNS1A "
CBMOAB-39408FYAMouse Anti-Rhesus CLNS1A Antibody (CBMOAB-39408FYA)
MO-AB-23631WMouse Anti-Chimpanzee CLNS1A Antibody (MO-AB-23631W)
CBMOAB-70790FYAMouse Anti-Zebrafish clns1a Antibody (CBMOAB-70790FYA)
MO-AB-24886HMouse Anti-Rat Clns1a Antibody (MO-AB-24886H)
MO-AB-29600WMouse Anti-Dog CLNS1A Antibody (MO-AB-29600W)
MO-AB-07637YMouse Anti-Rabbit CLNS1A Antibody (MO-AB-07637Y)
MO-AB-36893WMouse Anti-Goat CLNS1A Antibody (MO-AB-36893W)
For Research Use Only | Not For Clinical Use.
Online Inquiry