Mouse Anti-Zebrafish clns1a Antibody (CBMOAB-70790FYA)


Cat: CBMOAB-70790FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO70790FYA
SpecificityThis antibody binds to Zebrafish clns1a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Plasma Membrane; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that functions in multiple regulatory pathways. The encoded protein complexes with numerous cytosolic proteins and performs diverse functions including regulation of small nuclear ribonucleoprotein biosynthesis, platelet activation and cytoskeletal organization. The protein is also found associated with the plasma membrane where it functions as a chloride current regulator. Pseudogenes of this gene are found on chromosomes 1, 4 and 6. Several transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Zebrafish clns1a Antibody is a mouse antibody against clns1a. It can be used for clns1a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSwelling dependent chloride channel; clns1a; icl
UniProt IDQ7ZTV8
Protein RefseqThe length of the protein is 249 amino acids long.
The sequence is show below: MVLLKSLPPPSEGVRLQQAETTAVLDGKRLGLGTLFVAEAQLSWFDGSGMGFCLEYPTISLHAISRDLSAFPEEHLYVMVNAKLDDEGEAAPLEKDPDEEDENEEDSDSEGSGEITEIRFVPSDKAALEPMFSAMCDCQALHPDPDDADSEDDDDYEGEEYDVEEAEQEQAQAHGDIPSFYTYEEGLSHLTAEGQATLERLEGMLAQSVAQQYHMAGVRTEEPDAQFEDGMEVDSNTVAGQFDDADVDH.
For Research Use Only | Not For Clinical Use.
Online Inquiry