Mouse Anti-Rabbit CLNS1A Antibody (MO-AB-07637Y)
Cat: MO-AB-07637Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rabbit (Oryctolagus cuniculus) |
| Clone | MO07637Y |
| Specificity | This antibody binds to Rabbit CLNS1A. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Plasma membrane; Cytosol; Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Involved in both the assembly of spliceosomal snRNPs and the methylation of Sm proteins (By similarity). Chaperone that regulates the assembly of spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Thereby, plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP. In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A that controls the assembly of the core snRNP. Dissociation by the SMN complex of CLNS1A from the trapped Sm proteins and their transfer to an SMN-Sm complex triggers the assembly of core snRNPs and their transport to the nucleus. May also indirectly participate in cellular volume control by activation of a swelling-induced chloride conductance pathway. Involved in the methylation of Sm proteins by PRMT5 (By similarity). |
| Product Overview | This product is a mouse antibody against CLNS1A. It can be used for CLNS1A detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Methylosome subunit pICln; CLNS1A |
| UniProt ID | G1THY2 |
| Protein Refseq | The length of the protein is 241 amino acids long. The sequence is show below: AFGAAMSFLRSFLPPGPTEGLRHQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHAVSRDPNAYPQEHLYVMVNAKFGEESKELVADEEEDSDDDVEPISEFRFVPGDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH. |
See other products for " CLNS1A "
| CBMOAB-39408FYA | Mouse Anti-Rhesus CLNS1A Antibody (CBMOAB-39408FYA) |
| MO-AB-23631W | Mouse Anti-Chimpanzee CLNS1A Antibody (MO-AB-23631W) |
| CBMOAB-70790FYA | Mouse Anti-Zebrafish clns1a Antibody (CBMOAB-70790FYA) |
| MO-AB-24886H | Mouse Anti-Rat Clns1a Antibody (MO-AB-24886H) |
| MO-AB-53178W | Mouse Anti-Marmoset CLNS1A Antibody (MO-AB-53178W) |
| MO-AB-36893W | Mouse Anti-Goat CLNS1A Antibody (MO-AB-36893W) |
| MO-AB-29600W | Mouse Anti-Dog CLNS1A Antibody (MO-AB-29600W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry