Mouse Anti-Marmoset LSM3 Antibody (MO-AB-58434W)
Cat: MO-AB-58434W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Marmoset |
Clone | MO58434W |
Specificity | This antibody binds to Marmoset LSM3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Component of LSm protein complexes, which are involved in RNA processing and may function in a chaperone-like manner. Component of the cytoplasmic LSM1-LSM7 complex which is involved in mRNA degradation by activating the decapping step. Component of the nuclear LSM2-LSM8 complex, which is involved in splicing of nuclear mRNAs. LSM2-LSM8 associates with multiple snRNP complexes containing the U6 snRNA (U4/U6 snRNP, U4/U6.U5 snRNP, and free U6 snRNP). It binds directly to the U6 snRNA and plays a role in the biogenesis and stability of the U6 snRNP and U4/U6 snRNP complexes. It probably also is involved in degradation of nuclear pre-mRNA by targeting them for decapping. LSM3 binds specifically to the 3''-terminal U-tract of U6 snRNA. LSM2-LSM8 probably is involved in processing of pre-tRNAs, pre-rRNAs and U3 snoRNA. LSM3, probably in a complex that contains LSM2-LSM7 but not LSM1 or LSM8, associates with the precursor of the RNA component of RNase P (pre-P RNA) and may be involved in maturing pre-P RNA. LSM3 is required for processing of pre-tRNAs, pre-rRNAs and U3 snoRNA. |
Product Overview | Mouse Anti-Marmoset LSM3 Antibody is a mouse antibody against LSM3. It can be used for LSM3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | U6 snRNA-associated Sm-like protein LSm3; LOC100389959; LSM3 |
UniProt ID | F7ICR4 |
Protein Refseq | The length of the protein is 102 amino acids long. The sequence is show below: MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG. |
See other products for " LSM3 "
MO-AB-35068W | Mouse Anti-Ferret LSM3 Antibody (MO-AB-35068W) |
MO-AB-13901Y | Mouse Anti-Sea-anemone LSM3 Antibody (MO-AB-13901Y) |
MO-AB-11348W | Mouse Anti-Chimpanzee LSM3 Antibody (MO-AB-11348W) |
MO-AB-70037W | Mouse Anti-Silkworm LSM3 Antibody (MO-AB-70037W) |
MO-AB-11988Y | Mouse Anti-O. mykiss LSM3 Antibody (MO-AB-11988Y) |
MO-AB-43241W | Mouse Anti-Hamsters LSM3 Antibody (MO-AB-43241W) |
MO-AB-27789W | Mouse Anti-Cottonwood LSM3 Antibody (MO-AB-27789W) |
MO-AB-04929H | Mouse Anti-Frog lsm3 Antibody (MO-AB-04929H) |
CBMOAB-06190HCB | Mouse Anti-C. elegans LSM3 Antibody (CBMOAB-06190HCB) |
MO-AB-48624W | Mouse Anti-Maize LSM3 Antibody (MO-AB-48624W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry