Mouse Anti-Medaka SQSTM1 Antibody (MO-AB-01682R)


Cat: MO-AB-01682R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMedaka (Oryzias latipes)
CloneMO01682R
SpecificityThis antibody binds to Medaka SQSTM1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a multifunctional protein that binds ubiquitin and regulates activation of the nuclear factor kappa-B (NF-kB) signaling pathway. The protein functions as a scaffolding/adaptor protein in concert with TNF receptor-associated factor 6 to mediate activation of NF-kB in response to upstream signals. Alternatively spliced transcript variants encoding either the same or different isoforms have been identified for this gene. Mutations in this gene result in sporadic and familial Paget disease of bone.
Product OverviewThis product is a mouse antibody against SQSTM1. It can be used for SQSTM1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRNA-dependent DNA polymerase, Fragment; SQSTM1; p62
UniProt IDA0A090EUP1
Protein RefseqThe length of the protein is 374 amino acids long.
The sequence is show below: MSVTVKAYLLGKDEHVKEIRRFAVDQDVSCNFEYLSKKTAAVFSNLMNSSFNLFYKDENGDLVAFSSDDELMMGLGCVKDSTFRLYIKEKKEHRRDFPLHALPPFMFGHPPPHGPPHAPHHGPPPALHPNVTCDGCEGPVVGMRFKCSVCPDYDLCSTCQAQGKHTEHALLPIWHPLQWFPRGKWMKRMRHCMWNQNQNQNQNPEQQEQQDQPRPSASSGDGGEPSASQASVDFLKNIGEGVAAMLSPLGIDVDIDVEHDGQRSKVNPPTQAGGGDDNVAMDVNEGESATAERSKASRDSDEEWTHLSSKEVDPSTGELQSLDPKNHECELPSGGQQGPPSGGQQPSVGQQGPPSGGKQGPPSGGQQGPTGLRE.
For Research Use Only | Not For Clinical Use.
Online Inquiry