Mouse Anti-MYOG Antibody (CBMOAB-52091FYA)
Cat: CBMOAB-52091FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-52091FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO52091FYA | 100 µg | ||
MO-AB-13094W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO13094W | 100 µg | ||
MO-AB-45626W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO45626W | 100 µg | ||
MO-AB-59653W | Monoclonal | Marmoset | WB, ELISA | MO59653W | 100 µg | ||
MO-AB-16327R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO16327R | 100 µg | ||
MO-AB-27471R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO27471R | 100 µg | ||
MO-AB-05440H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO05440C | 100 µg | ||
MO-AB-27357H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27357C | 100 µg | ||
MO-AB-08919Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08919Y | 100 µg | ||
MO-AB-16239Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO16239Y | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) |
Clone | MO52091FYA |
Specificity | This antibody binds to Rhesus MYOG. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Myogenin is a muscle-specific transcription factor that can induce myogenesis in a variety of cell types in tissue culture. It is a member of a large family of proteins related by sequence homology, the helix-loop-helix (HLH) proteins. It is essential for the development of functional skeletal muscle. |
Product Overview | Mouse Anti-Rhesus MYOG Antibody is a mouse antibody against MYOG. It can be used for MYOG detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | MYOG |
UniProt ID | F7HM46 |
Protein Refseq | The length of the protein is 184 amino acids long. The sequence is show below: MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPETPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQTLLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFGANPG. |
See other products for " myog "
CBMOAB-88193FYA | Mouse Anti-myog Antibody (CBMOAB-88193FYA) |
MO-AB-33433H | Mouse Anti-MyoG Antibody (MO-AB-33433H) |
MO-AB-03037Y | Mouse Anti-MYOG Antibody (MO-AB-03037Y) |
MO-AB-37738W | Mouse Anti-MYOG Antibody (MO-AB-37738W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry