Mouse Anti-MyoG Antibody (MO-AB-33433H)


Cat: MO-AB-33433H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-33433H Monoclonal Nile tilapia (Oreochromis niloticus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO33433C 100 µg
MO-AB-13094W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13094W 100 µg
MO-AB-45626W Monoclonal Horse (Equus caballus) WB, ELISA MO45626W 100 µg
MO-AB-59653W Monoclonal Marmoset WB, ELISA MO59653W 100 µg
MO-AB-16327R Monoclonal Cattle (Bos taurus) WB, ELISA MO16327R 100 µg
MO-AB-27471R Monoclonal Pig (Sus scrofa) WB, ELISA MO27471R 100 µg
MO-AB-05440H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05440C 100 µg
MO-AB-27357H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27357C 100 µg
MO-AB-08919Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08919Y 100 µg
MO-AB-16239Y Monoclonal Sheep (Ovis aries) WB, ELISA MO16239Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityNile tilapia (Oreochromis niloticus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO33433C
SpecificityThis antibody binds to Nile tilapia MyoG.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMyogenin is a muscle-specific transcription factor that can induce myogenesis in a variety of cell types in tissue culture. It is a member of a large family of proteins related by sequence homology, the helix-loop-helix (HLH) proteins. It is essential for the development of functional skeletal muscle.
Product OverviewThis product is a mouse antibody against MyoG. It can be used for MyoG detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMyogenin; MyoG
UniProt IDD2XRC2
Protein RefseqThe length of the protein is 250 amino acids long.
The sequence is show below: MELFETNPYFFPDQRFYEGGDSYFPSRLPGAYDQAGYQDRNSMMGLCGNLSGGVGVGVTGTEDKASPSSMSPHSEPHCPGQCLPWACKLCKRKTVTMDRRRAATLREKRRLKKVNEAFDALKRSTLMNPNQRLPKVEILRSAIQYIERLQALVSSLNQQDTETGQQGLLYRPSPTQPRVSSSSEPSSGSTCCSSPEWSSTPEQCTQSYSSEDLLSAADSPEQGNMRALTSIVDSISAADGPVAFPVDIPK.
For Research Use Only | Not For Clinical Use.
Online Inquiry