Mouse Anti-MYOG Antibody (MO-AB-37738W)


Cat: MO-AB-37738W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-37738W Monoclonal Goat (Capra hircus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO37738W 100 µg
MO-AB-13094W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13094W 100 µg
MO-AB-45626W Monoclonal Horse (Equus caballus) WB, ELISA MO45626W 100 µg
MO-AB-59653W Monoclonal Marmoset WB, ELISA MO59653W 100 µg
MO-AB-16327R Monoclonal Cattle (Bos taurus) WB, ELISA MO16327R 100 µg
MO-AB-27471R Monoclonal Pig (Sus scrofa) WB, ELISA MO27471R 100 µg
MO-AB-05440H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05440C 100 µg
MO-AB-27357H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27357C 100 µg
MO-AB-08919Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08919Y 100 µg
MO-AB-16239Y Monoclonal Sheep (Ovis aries) WB, ELISA MO16239Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGoat (Capra hircus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO37738W
SpecificityThis antibody binds to Goat MYOG.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Goat MYOG Antibody is a mouse antibody against MYOG. It can be used for MYOG detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMyogenin; MyoG
UniProt IDB9VV80
Protein RefseqThe length of the protein is 224 amino acids long.
The sequence is show below: MELYETSPYFYQEPHFYDGENYLPVHLQGFEPPGYERAELGLSPEARVPLEDKGLGPAEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPQWGSALEFGPNPGDHLLPADPTDAHNLHSLTSIVDSITVEDVTAAFPDETIPN.
For Research Use Only | Not For Clinical Use.
Online Inquiry