Mouse Anti-Nile tilapia AK6 Antibody (MO-AB-32819H)


Cat: MO-AB-32819H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityNile tilapia (Oreochromis niloticus)
CloneMO32819C
SpecificityThis antibody binds to Nile tilapia AK6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that belongs to the adenylate kinase family of enzymes. The protein has a nuclear localization and contains Walker A (P-loop) and Walker B motifs and a metal-coordinating residue. The protein may be involved in regulation of Cajal body formation. In human, AK6 and TAF9 (GeneID: 6880) are two distinct genes that share 5' exons. Alternative splicing results in multiple transcript variants.
Product OverviewThis product is a mouse antibody against AK6. It can be used for AK6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdenylate kinase isoenzyme 6; AK6; EC 2.7.4.3; Coilin-interacting nuclear ATPase protein; Dual activity adenylate kinase/ATPase; LOC100700413
UniProt IDI3K8S1
Protein RefseqThe length of the protein is 174 amino acids long.
The sequence is show below: MKTKKQPNILLTGTPGVGKTTLGKELAQRTGLTYVNIGDLAQEGQLFDGYDEEYQCPILDEDRVVDELDEKMSEGGVIVDYHGCDLFPERWFDIVFVLRTDNTQLYTRLEARGYTGKKLQDNVQCEIFQTIYEEAMEAYSKEIVHQLPSNTPEDMEHNLDQIVQWTEQWMKDHN.
For Research Use Only | Not For Clinical Use.
Online Inquiry