Mouse Anti-Nile tilapia HDAC3 Antibody (MO-AB-33287H)


Cat: MO-AB-33287H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityNile tilapia (Oreochromis niloticus)
CloneMO33287C
SpecificityThis antibody binds to Nile tilapia HDAC3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionHistones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. It may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. This protein can also down-regulate p53 function and thus modulate cell growth and apoptosis. This gene is regarded as a potential tumor suppressor gene.
Product OverviewThis product is a mouse antibody against HDAC3. It can be used for HDAC3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHistone deacetylase; EC 3.5.1.98; LOC100708372
UniProt IDI3KFN8
Protein RefseqThe length of the protein is 430 amino acids long.
The sequence is show below: MTNRTSYFYDPDVGNFHYGAGHPMKPHRLSLTHSLVLHYGLYKKMMVFKPYKASQHDMCRFHSEDYIDFLQKVSPNNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNHKICDIAINWAGGLHHAKKFEASGFCYVNDIVISILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYRQLFQPVIKQVVDYYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGFFQLNSNVKSFRIPLLVLGGGGYTVRNVARCWTYETSLLLDESISDELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLEQIRQTVFENLKMLNHAPSVQIHDVPSDMLSYERNDEPDPDERGAEENYTRPEAANEFYDGDHDNDKESDVEI.
For Research Use Only | Not For Clinical Use.
Online Inquiry