Mouse Anti-Cattle HDAC3 Antibody (MO-AB-13593R)
Cat: MO-AB-13593R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Cattle (Bos taurus) |
Clone | MO13593R |
Specificity | This antibody binds to Cattle HDAC3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. It may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. This protein can also down-regulate p53 function and thus modulate cell growth and apoptosis. This gene is regarded as a potential tumor suppressor gene. [provided by RefSeq, Jul 2008] |
Product Overview | Mouse Anti-Cattle HDAC3 Antibody is a mouse antibody against HDAC3. It can be used for HDAC3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Histone deacetylase 3, Fragment; HDAC3 |
UniProt ID | Q6RCM5 |
Protein Refseq | The length of the protein is 69 amino acids long. The sequence is show below: GECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTR. |
See other products for " HDAC3 "
MO-AB-45019W | Mouse Anti-Horse HDAC3 Antibody (MO-AB-45019W) |
MO-DKB-00716W | Rabbit Anti-HDAC3 Antibody (MO-DKB-00716W) |
MO-AB-12508W | Mouse Anti-Chimpanzee HDAC3 Antibody (MO-AB-12508W) |
MO-DKB-01169W | Rabbit Anti-HDAC3 Antibody (MO-DKB-01169W) |
CBMOAB-18410FYA | Mouse Anti-D. melanogaster Hdac3 Antibody (CBMOAB-18410FYA) |
CBMOAB-79192FYA | Mouse Anti-Zebrafish hdac3 Antibody (CBMOAB-79192FYA) |
MO-AB-34877W | Mouse Anti-Ferret HDAC3 Antibody (MO-AB-34877W) |
MO-AB-33287H | Mouse Anti-Nile tilapia HDAC3 Antibody (MO-AB-33287H) |
MO-AB-15622Y | Mouse Anti-Sheep HDAC3 Antibody (MO-AB-15622Y) |
MO-AB-56618W | Mouse Anti-Marmoset HDAC3 Antibody (MO-AB-56618W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry