Mouse Anti-Marmoset HDAC3 Antibody (MO-AB-56618W)


Cat: MO-AB-56618W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO56618W
SpecificityThis antibody binds to Marmoset HDAC3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytoskeleton; Plasma membrane; Cytosol; Golgi apparatus; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionHistones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. It may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. This protein can also down-regulate p53 function and thus modulate cell growth and apoptosis. This gene is regarded as a potential tumor suppressor gene.
Product OverviewMouse Anti-Marmoset HDAC3 Antibody is a mouse antibody against HDAC3. It can be used for HDAC3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHistone deacetylase; EC 3.5.1.98; HDAC3
UniProt IDF6RM17
Protein RefseqThe length of the protein is 428 amino acids long.
The sequence is show below: MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI.
See other products for " HDAC3 "
MO-AB-41801WMouse Anti-Guinea pig HDAC3 Antibody (MO-AB-41801W)
MO-AB-07954WMouse Anti-Cat HDAC3 Antibody (MO-AB-07954W)
MO-AB-33287HMouse Anti-Nile tilapia HDAC3 Antibody (MO-AB-33287H)
MO-AB-31101WMouse Anti-Dog HDAC3 Antibody (MO-AB-31101W)
MO-DKB-00716WRabbit Anti-HDAC3 Antibody (MO-DKB-00716W)
MO-AB-15622YMouse Anti-Sheep HDAC3 Antibody (MO-AB-15622Y)
MO-AB-13593RMouse Anti-Cattle HDAC3 Antibody (MO-AB-13593R)
MO-AB-34877WMouse Anti-Ferret HDAC3 Antibody (MO-AB-34877W)
MO-AB-00645RMouse Anti-Medaka HDAC3 Antibody (MO-AB-00645R)
MO-AB-45019WMouse Anti-Horse HDAC3 Antibody (MO-AB-45019W)
For Research Use Only | Not For Clinical Use.
Online Inquiry