Mouse Anti-Nile tilapia med6 Antibody (MO-AB-33385H)


Cat: MO-AB-33385H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityNile tilapia (Oreochromis niloticus)
CloneMO33385C
SpecificityThis antibody binds to Nile tilapia med6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMED6 (Mediator Complex Subunit 6) is a protein coding gene. Among its related pathways are Gene Expression and Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha). Gene Ontology (GO) annotations related to this gene include transcription factor binding and RNA polymerase II transcription cofactor activity.
Product OverviewThis product is a mouse antibody against med6. It can be used for med6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMediator of RNA polymerase II transcription subunit 6; Mediator complex subunit 6; LOC100697418
UniProt IDI3KU73
Protein RefseqThe length of the protein is 246 amino acids long.
The sequence is show below: MASVDFRDNLLGISWVDSNWVPGLNPGNVLEYFSDRSNPFYDRTCNNEVVKMQRLTVDHLNQMVGVEYILLHAQEPILYIIRKQQRQSPTQVVPLADYYIIAGVVYQAPDLGTVISSRVLSAVHGIQSAFDEAMSYCRYHPSKGYWWHFKDHEEREKAKPKTKKKEEPSSLFQRHRVDTLLLDLRSKFPPTFYQPKPGEKPIPVEVKKEPEPPAETVKQEEREQATKSSAPAPPNKPPPEKRARLQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry