Mouse Anti-O. mykiss CASP6 Antibody (MO-AB-10801Y)
Cat: MO-AB-10801Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | O. mykiss (Oncorhynchus mykiss) |
| Clone | MO10801Y |
| Specificity | This antibody binds to O. mykiss CASP6. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the cysteine-aspartic acid protease (caspase) family of enzymes. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic acid residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein is processed by caspases 7, 8 and 10, and is thought to function as a downstream enzyme in the caspase activation cascade. Alternative splicing of this gene results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Oct 2015] |
| Product Overview | This product is a mouse antibody against CASP6. It can be used for CASP6 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Caspase-6; CASP6 |
| UniProt ID | C1BI95 |
| Protein Refseq | The length of the protein is 88 amino acids long. The sequence is show below: MSCPVNKDTKGSLEKDNKTSQTTGPSENLTETDGYFCSSFSMDPAEEYKMNHKRRGLALIFNQEHFFWHLRMPPRNGTNADRSNLCHR. |
See other products for " CASP6 "
| MO-AB-07474W | Mouse Anti-Cat CASP6 Antibody (MO-AB-07474W) |
| MO-DKB-03702W | Rabbit Anti-CASP6 Antibody (Cat MO-DKB-03702W) |
| MO-AB-24605W | Mouse Anti-Chimpanzee CASP6 Antibody (MO-AB-24605W) |
| MO-AB-02078H | Mouse Anti-Frog casp6 Antibody (MO-AB-02078H) |
| CBMOAB-69083FYA | Mouse Anti-Zebrafish casp6 Antibody (CBMOAB-69083FYA) |
| MO-AB-52288W | Mouse Anti-Marmoset CASP6 Antibody (MO-AB-52288W) |
| CBMOAB-38182FYA | Mouse Anti-Rhesus CASP6 Antibody (CBMOAB-38182FYA) |
| MOFY-0722-FY50 | Mouse Anti-CASP6 Antibody (MOFY-0722-FY50) |
| MO-AB-09518R | Mouse Anti-Cattle CASP6 Antibody (MO-AB-09518R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry