Mouse Anti-Rhesus CASP6 Antibody (CBMOAB-38182FYA)


Cat: CBMOAB-38182FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO38182FYA
SpecificityThis antibody binds to Rhesus CASP6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the cysteine-aspartic acid protease (caspase) family of enzymes. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic acid residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein is processed by caspases 7, 8 and 10, and is thought to function as a downstream enzyme in the caspase activation cascade. Alternative splicing of this gene results in multiple transcript variants that encode different isoforms.
Product OverviewMouse Anti-Rhesus CASP6 Antibody is a mouse antibody against CASP6. It can be used for CASP6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCASP6
UniProt IDF7GYT8
Protein RefseqThe length of the protein is 290 amino acids long.
The sequence is show below: MSSASGLRGVHPAVGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWRLTLPERRGTCTDRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTSSHADADCFVCVFLSHGEGNHVYAFYHSGKTDYVVILIIKSVIWNILPLKPKLFPRCQIGFRDKSIFYRINLFSHLRRVKKNLSHIYHGHILRLFCSNIFLLTFLGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSN.
For Research Use Only | Not For Clinical Use.
Online Inquiry