Mouse Anti-Pig ATM Antibody (MO-AB-23928R)
Cat: MO-AB-23928R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Pig (Sus scrofa) |
| Clone | MO23928R |
| Specificity | This antibody binds to Pig ATM. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Other locations; Nucleus; Cytoskeleton |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene belongs to the PI3/PI4-kinase family. This protein is an important cell cycle checkpoint kinase that phosphorylates; thus, it functions as a regulator of a wide variety of downstream proteins, including tumor suppressor proteins p53 and BRCA1, checkpoint kinase CHK2, checkpoint proteins RAD17 and RAD9, and DNA repair protein NBS1. This protein and the closely related kinase ATR are thought to be master controllers of cell cycle checkpoint signaling pathways that are required for cell response to DNA damage and for genome stability. Mutations in this gene are associated with ataxia telangiectasia, an autosomal recessive disorder. Serine/threonine protein kinase which activates checkpoint signaling upon double strand breaks (DSBs), apoptosis and genotoxic stresses such as ionizing ultraviolet A light (UVA), thereby acting as a DNA damage sensor. Recognizes the substrate consensus sequence [ST]-Q. Phosphorylates 'Ser-139' of histone variant H2AX at double strand breaks (DSBs), thereby regulating DNA damage response mechanism. Also plays a role in pre-B cell allelic exclusion, a process leading to expression of a single immunoglobulin heavy chain allele to enforce clonality and monospecific recognition by the B-cell antigen receptor (BCR) expressed on individual B-lymphocytes. After the introduction of DNA breaks by the RAG complex on one immunoglobulin allele, acts by mediating a repositioning of the second allele to pericentromeric heterochromatin, preventing accessibility to the RAG complex and recombination of the second allele. Also involved in signal transduction and cell cycle control. May function as a tumor suppressor. Necessary for activation of ABL1 and SAPK. Phosphorylates DYRK2, CHEK2, p53/TP53, FANCD2, NFKBIA, BRCA1, CTIP, nibrin (NBN), TERF1, RAD9, UBQLN4 and DCLRE1C. May play a role in vesicle and/or protein transport. Could play a role in T-cell development, gonad and neurological function. Binds DNA ends. Plays a role in replication-dependent histone mRNA degradation. Phosphorylation of DYRK2 in nucleus in response to genotoxic stress prevents its MDM2-mediated ubiquitination and subsequent proteasome degradation. Phosphorylates ATF2 which stimulates its function in DNA damage response. Phosphorylates ERCC6 which is essential for its chromatin remodeling activity at DNA double-strand breaks. |
| Product Overview | This product is a mouse antibody against ATM. It can be used for ATM detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Serine-protein kinase ATM; ATM |
| UniProt ID | F1SV20 |
| Protein Refseq | The length of the protein is 252 amino acids long. The sequence is show below: MMEAQNKSFEEKYEIFMNICQNFQPVFRYFCMEKFLDPAVWFERRLAYTQSVATSSIVGYILGLGDRHVQNILINEQSAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTMEVMRNSQETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDESELHSTPRADDQECKRNLSDTDQSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNFLIQQAMDPKNLSKLFSGWKAWV. |
See other products for " ATM "
| MOFAB-051W | Mouse Anti-ATM Antibody (MOFAB-051W) |
| MO-AB-01687H | Mouse Anti-Frog atm Antibody (MO-AB-01687H) |
| MO-AB-29073W | Mouse Anti-Dog ATM Antibody (MO-AB-29073W) |
| MO-AB-30576H | Mouse Anti-Purple sea urchin ATM Antibody (MO-AB-30576H) |
| CBMOAB-36516FYA | Mouse Anti-Rhesus ATM Antibody (CBMOAB-36516FYA) |
| CBMOAB-24677FYC | Mouse Anti-Arabidopsis ATM Antibody (CBMOAB-24677FYC) |
| MO-AB-00211Y | Mouse Anti-Chicken ATM Antibody (MO-AB-00211Y) |
| CBMOAB-66956FYA | Mouse Anti-Zebrafish atm Antibody (CBMOAB-66956FYA) |
| MO-AB-24204W | Mouse Anti-Chimpanzee ATM Antibody (MO-AB-24204W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry