Mouse Anti-Rabbit APP Antibody (MO-AB-07235Y)


Cat: MO-AB-07235Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRabbit (Oryctolagus cuniculus)
CloneMO07235Y
SpecificityThis antibody binds to Rabbit APP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Extracellular region or secreted; Plasma membrane; Endosome; Plasma membrane; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionFunctions as a cell surface receptor and performs physiological functions on the surface of neurons relevant to neurite growth, neuronal adhesion and axonogenesis. Interaction between APP molecules on neighboring cells promotes synaptogenesis. Involved in cell mobility and transcription regulation through protein-protein interactions (By similarity). Can promote transcription activation through binding to APBB1-KAT5 and inhibit Notch signaling through interaction with Numb (By similarity). Couples to apoptosis-inducing pathways such as those mediated by G(O) and JIP (By similarity). Inhibits G(o) alpha ATPase activity (By similarity). Acts as a kinesin I membrane receptor, mediating the axonal transport of beta-secretase and presenilin 1 (By similarity). By acting as a kinesin I membrane receptor, plays a role in axonal anterograde transport of cargo towards synapes in axons (By similarity). May be involved in copper homeostasis/oxidative stress through copper ion reduction (By similarity). In vitro, copper-metallated APP induces neuronal death directly or is potentiated through Cu-mediated low-density lipoprotein oxidation (By similarity). Can regulate neurite outgrowth through binding to components of the extracellular matrix such as heparin and collagen I and IV. Induces a AGER-dependent pathway that involves activation of p38 MAPK, resulting in internalization of amyloid-beta peptide and mitochondrial dysfunction in cultured cortical neurons. Provides Cu ions for GPC1 which are required for release of nitric oxide (NO) and subsequent degradation of the heparan sulfate chains on GPC1 (By similarity).
Product OverviewThis product is a mouse antibody against APP. It can be used for APP detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesAmyloid beta A4 protein; ABPP; APP; Alzheimer disease amyloid A4 protein homolog; [Cleaved into: Soluble APP-beta (S-APP-beta); CTF-alpha; Beta-amyloid protein 42 (Beta-APP42); Beta-amyloid protein 40 (Beta-APP40); Gamma-secretase C-terminal fragment 59 (Gamma-CTF(59)); Gamma-secretase C-terminal fragment 57 (Gamma-CTF(57))]; APP
UniProt IDQ28748
Protein RefseqThe length of the protein is 58 amino acids long. The sequence is show below: SEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLK.
See other products for " APP "
MO-AB-29002WMouse Anti-Dog APP Antibody (MO-AB-29002W)
MO-AB-01500HMouse Anti-Frog app Antibody (MO-AB-01500H)
MO-AB-00156YMouse Anti-Chicken APP Antibody (MO-AB-00156Y)
CBMOAB-36084FYAMouse Anti-Rhesus APP Antibody (CBMOAB-36084FYA)
MO-AB-08377WMouse Anti-Cat APP Antibody (MO-AB-08377W)
MO-AB-00093LMouse Anti-Elephant APP Antibody (MO-AB-00093L)
MO-AB-24129HMouse Anti-Rat APP Antibody (MO-AB-24129H)
MO-AB-14223YMouse Anti-Sheep APP Antibody (MO-AB-14223Y)
MO-AB-41259WMouse Anti-Guinea pig APP Antibody (MO-AB-41259W)
MO-AB-07514RMouse Anti-Cattle APP Antibody (MO-AB-07514R)
For Research Use Only | Not For Clinical Use.
Online Inquiry