Mouse Anti-Rat Cd8a Antibody (MO-AB-24659H)


Cat: MO-AB-24659H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO24659C
SpecificityThis antibody binds to Rat Cd8a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD8A (CD8a Molecule) is a protein coding gene. Diseases associated with CD8A include Cd8 Deficiency, Familial and Primary Cutaneous Aggressive Epidermotropic Cd8+ T-Cell Lymphoma. Among its related pathways are Hematopoietic Stem Cell Differentiation Pathways and Lineage-specific Markers and T-Cell Receptor and Co-stimulatory Signaling. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and coreceptor activity.
Product OverviewThis product is a mouse antibody against Cd8a. It can be used for Cd8a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesT-cell surface glycoprotein CD8 alpha chain; CD8 antigen 32 kDa chain; OX-8 membrane antigen; CD antigen CD8a; Cd8a
UniProt IDP07725
Protein RefseqThe length of the protein is 236 amino acids long.
The sequence is show below: MASRVICFLSLNLLLLDVITRLQVSGQLQLSPKKVDAEIGQEVKLTCEVLRDTSQGCSWLFRNSSSELLQPTFIIYVSSSRSKLNDILDPNLFSARKENNKYILTLSKFSTKNQGYYFCSITSNSVMYFSPLVPVFQKVNSIITKPVTRAPTPVPPPTGTPRPLRPEACRPGASGSVEGMGLGFACDIYIWAPLAGICAVLLLSLVITLICCHRNRRRVCKCPRPLVKPRPSEKFV.

Reference

ReferenceTorres-Nagel, N., Kraus, E., Brown, M. H., Tiefenthaler, G., Mitnacht, R., Williams, A. F., & Hünig, T. (1992). Differential thymus dependence of rat CD8 isoform expression. European journal of immunology, 22(11), 2841-2848.
See other products for " CD8A "
CBMOAB-00169FYAMouse Anti-Goat CD8A Antibody (CBMOAB-00169FYA)
CBMOAB-00145FYAMouse Anti-Horse CD8A Antibody (CBMOAB-00145FYA)
CBMOAB-00175FYAMouse Anti-Rabbit CD8A Antibody (CBMOAB-00175FYA)
CBMOAB-00220FYAMouse Anti-Alpaca CD8A Antibody (CBMOAB-00220FYA)
MO-AB-08086WMouse Anti-Cat CD8A Antibody (MO-AB-08086W)
CBMOAB-00146FYAMouse Anti-Horse CD8A Antibody (CBMOAB-00146FYA)
CBMOAB-00081FYAMouse Anti-Cattle CD8A Antibody (CBMOAB-00081FYA)
MO-NAB-00316WRat Anti-Mouse CD8A Antibody
MO-AB-01078YMouse Anti-Chicken CD8A Antibody (MO-AB-01078Y)
CBMOAB-00132FYAMouse Anti-Dog CD8A Antibody (CBMOAB-00132FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry