Mouse Anti-Rat Lsm7 Antibody (MO-AB-26861H)
Cat: MO-AB-26861H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rat (Rattus norvegicus) |
Clone | MO26861C |
Specificity | This antibody binds to Rat Lsm7. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Component of LSm protein complexes, which are involved in RNA processing and may function in a chaperone-like manner. Component of the cytoplasmic LSM1-LSM7 complex which is involved in mRNA degradation by activating the decapping step. Component of the nuclear LSM2-LSM8 complex, which is involved in splicing of nuclear mRNAs. LSM2-LSM8 associates with multiple snRNP complexes containing the U6 snRNA (U4/U6 snRNP, spliceosomal U4/U6.U5 snRNP, and free U6 snRNP). It binds directly to the U6 snRNA and plays a role in the biogenesis and stability of the U6 snRNP and U4/U6 snRNP complexes. It probably also is involved in degradation of nuclear pre-mRNA by targeting them for decapping. LSM7 binds specifically to the 3''-terminal U-tract of U6 snRNA. LSM2-LSM8 probably is involved in processing of pre-tRNAs, pre-rRNAs and U3 snoRNA. LSM7, probably in a complex that contains LSM2-LSM7 but not LSM1 or LSM8, associates with the precursor of the RNA component of RNase P (pre-P RNA) and may be involved in maturing pre-P RNA. |
Product Overview | This product is a mouse antibody against Lsm7. It can be used for Lsm7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae), isoform CRA_d; Protein Lsm7; Lsm7 |
UniProt ID | D4A2D8 |
Protein Refseq | The length of the protein is 103 amino acids long. The sequence is show below: MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFVQQQDT. |
See other products for " LSM7 "
CBMOAB-06194HCB | Mouse Anti-C. elegans LSM7 Antibody (CBMOAB-06194HCB) |
CBMOAB-02111CR | Mouse Anti-Yeast LSM7 Antibody (CBMOAB-02111CR) |
MO-AB-11995Y | Mouse Anti-O. mykiss LSM7 Antibody (MO-AB-11995Y) |
CBMOAB-23329FYA | Mouse Anti-D. melanogaster Lsm7 Antibody (CBMOAB-23329FYA) |
MO-AB-11409W | Mouse Anti-Chimpanzee LSM7 Antibody (MO-AB-11409W) |
CBMOAB-49302FYA | Mouse Anti-Rhesus LSM7 Antibody (CBMOAB-49302FYA) |
MO-AB-04933H | Mouse Anti-Frog lsm7 Antibody (MO-AB-04933H) |
MO-AB-58436W | Mouse Anti-Marmoset LSM7 Antibody (MO-AB-58436W) |
CBMOAB-85576FYA | Mouse Anti-Zebrafish lsm7 Antibody (CBMOAB-85576FYA) |
CBMOAB-36028FYC | Mouse Anti-Arabidopsis LSM7 Antibody (CBMOAB-36028FYC) |
For Research Use Only | Not For Clinical Use.
Online Inquiry