Mouse Anti-Rhesus LSM7 Antibody (CBMOAB-49302FYA)
Cat: CBMOAB-49302FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta) |
| Clone | MO49302FYA |
| Specificity | This antibody binds to Rhesus LSM7. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Component of LSm protein complexes, which are involved in RNA processing and may function in a chaperone-like manner. Component of the cytoplasmic LSM1-LSM7 complex which is involved in mRNA degradation by activating the decapping step. Component of the nuclear LSM2-LSM8 complex, which is involved in splicing of nuclear mRNAs. LSM2-LSM8 associates with multiple snRNP complexes containing the U6 snRNA (U4/U6 snRNP, spliceosomal U4/U6.U5 snRNP, and free U6 snRNP). It binds directly to the U6 snRNA and plays a role in the biogenesis and stability of the U6 snRNP and U4/U6 snRNP complexes. It probably also is involved in degradation of nuclear pre-mRNA by targeting them for decapping. LSM7 binds specifically to the 3''-terminal U-tract of U6 snRNA. LSM2-LSM8 probably is involved in processing of pre-tRNAs, pre-rRNAs and U3 snoRNA. LSM7, probably in a complex that contains LSM2-LSM7 but not LSM1 or LSM8, associates with the precursor of the RNA component of RNase P (pre-P RNA) and may be involved in maturing pre-P RNA. |
| Product Overview | Mouse Anti-Rhesus LSM7 Antibody is a mouse antibody against LSM7. It can be used for LSM7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | U6 snRNA-associated Sm-like protein LSm7; LSM7 |
| UniProt ID | H9FB86 |
| Protein Refseq | The length of the protein is 80 amino acids long. The sequence is show below: RVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQQDA. |
See other products for " LSM7 "
| CBMOAB-36028FYC | Mouse Anti-Arabidopsis LSM7 Antibody (CBMOAB-36028FYC) |
| MO-AB-11409W | Mouse Anti-Chimpanzee LSM7 Antibody (MO-AB-11409W) |
| CBMOAB-85576FYA | Mouse Anti-Zebrafish lsm7 Antibody (CBMOAB-85576FYA) |
| CBMOAB-02111CR | Mouse Anti-Yeast LSM7 Antibody (CBMOAB-02111CR) |
| MO-AB-26861H | Mouse Anti-Rat Lsm7 Antibody (MO-AB-26861H) |
| MO-AB-58436W | Mouse Anti-Marmoset LSM7 Antibody (MO-AB-58436W) |
| CBMOAB-23329FYA | Mouse Anti-D. melanogaster Lsm7 Antibody (CBMOAB-23329FYA) |
| MO-AB-04933H | Mouse Anti-Frog lsm7 Antibody (MO-AB-04933H) |
| CBMOAB-06194HCB | Mouse Anti-C. elegans LSM7 Antibody (CBMOAB-06194HCB) |
| MO-AB-11995Y | Mouse Anti-O. mykiss LSM7 Antibody (MO-AB-11995Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry